KEGG   Homo sapiens (human): 6373Help
Entry
6373              CDS       T01001                                 

Gene name
CXCL11, H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1
Definition
chemokine (C-X-C motif) ligand 11
Orthology
K12672  
C-X-C motif chemokine 11
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
Disease
H01360  
Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6373 (CXCL11)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    6373 (CXCL11)
   04062 Chemokine signaling pathway
    6373 (CXCL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.2
AA seq 94 aa AA seqDB search
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI
EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaagggcatggctatagccttggctgtgatattgtgtgctacagttgttcaa
ggcttccccatgttcaaaagaggacgctgtctttgcataggccctggggtaaaagcagtg
aaagtggcagatattgagaaagcctccataatgtacccaagtaacaactgtgacaaaata
gaagtgattattaccctgaaagaaaataaaggacaacgatgcctaaatcccaaatcgaag
caagcaaggcttataatcaaaaaagttgaaagaaagaatttttaa

DBGET integrated database retrieval system