KEGG   Homo sapiens (human): 6375Help
Entry
6375              CDS       T01001                                 

Gene name
XCL1, ATAC, LPTN, LTN, SCM-1, SCM-1a, SCM1, SCM1A, SCYC1
Definition
chemokine (C motif) ligand 1
Orthology
K05507  
C motif chemokine 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 114 aa AA seqDB search
MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagacttctcatcctggccctccttggcatctgctctctcactgcatacattgtggaa
ggtgtagggagtgaagtctcagataagaggacctgtgtgagcctcactacccagcgactg
ccggttagcagaatcaagacctacaccatcacggaaggctccttgagagcagtaattttt
attaccaaacgtggcctaaaagtctgtgctgatccacaagccacatgggtgagagacgtg
gtcaggagcatggacaggaaatccaacaccagaaataacatgatccagaccaagccaaca
ggaacccagcaatcgaccaatacagctgtgactctgactggctag

DBGET integrated database retrieval system