KEGG   Homo sapiens (human): 6376Help
Entry
6376              CDS       T01001                                 

Gene name
CX3CL1, ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
Definition
(RefSeq) C-X3-C motif chemokine ligand 1
  KO
K05508  C-X3-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6376 (CX3CL1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6376 (CX3CL1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6376 (CX3CL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6376 (CX3CL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6376
NCBI-ProteinID: NP_002987
OMIM: 601880
HGNC: 10647
Ensembl: ENSG00000006210
Vega: OTTHUMG00000133469
Pharos: P78423(Tbio)
UniProt: P78423 A0N0N7
Structure
PDB: 

Jmol
Position
16q21
AA seq 397 aa AA seqDB search
MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctccgatatctctgtcgtggctgctccgcttggccaccttctgccatctgactgtc
ctgctggctggacagcaccacggtgtgacgaaatgcaacatcacgtgcagcaagatgaca
tcaaagatacctgtagctttgctcatccactatcaacagaaccaggcatcatgcggcaaa
cgcgcaatcatcttggagacgagacagcacaggctgttctgtgccgacccgaaggagcaa
tgggtcaaggacgcgatgcagcatctggaccgccaggctgctgccctaactcgaaatggc
ggcaccttcgagaagcagatcggcgaggtgaagcccaggaccacccctgccgccggggga
atggacgagtctgtggtcctggagcccgaagccacaggcgaaagcagtagcctggagccg
actccttcttcccaggaagcacagagggccctggggacctccccagagctgccgacgggc
gtgactggttcctcagggaccaggctccccccgacgccaaaggctcaggatggagggcct
gtgggcacggagcttttccgagtgcctcccgtctccactgccgccacgtggcagagttct
gctccccaccaacctgggcccagcctctgggctgaggcaaagacctctgaggccccgtcc
acccaggacccctccacccaggcctccactgcgtcctccccagccccagaggagaatgct
ccgtctgaaggccagcgtgtgtggggtcagggacagagccccaggccagagaactctctg
gagcgggaggagatgggtcccgtgccagcgcacacggatgccttccaggactgggggcct
ggcagcatggcccacgtctctgtggtccctgtctcctcagaagggacccccagcagggag
ccagtggcttcaggcagctggacccctaaggctgaggaacccatccatgccaccatggac
ccccagaggctgggcgtccttatcactcctgtccctgacgcccaggctgccacccggagg
caggcggtggggctgctggccttccttggcctcctcttctgcctgggggtggccatgttc
acctaccagagcctccagggctgccctcgaaagatggcaggagagatggcggagggcctt
cgctacatcccccggagctgtggtagtaattcatatgtcctggtgcccgtgtga

DBGET integrated database retrieval system