KEGG   Homo sapiens (human): 63826Help
Entry
63826             CDS       T01001                                 

Gene name
SRR, ILV1, ISO1
Definition
(RefSeq) serine racemase
  KO
K12235  
serine racemase [EC:5.1.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    63826 (SRR)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.18  serine racemase
     63826 (SRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9GZT4(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.3
AA seq 340 aa AA seqDB search
MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGA
LNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQA
YGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDAL
VVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGV
KSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQT
VSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctcagtattgcatctcctttgctgatgttgaaaaagctcatatcaacattcga
gattctatccacctcacaccagtgctaacaagctccattttgaatcaactaacagggcgc
aatcttttcttcaaatgtgaactcttccagaaaacaggatcttttaagattcgtggtgct
ctcaatgccgtcagaagcttggttcctgatgctttagaaaggaagccgaaagctgttgtt
actcacagcagtggaaaccatggccaggctctcacctatgctgccaaattggaaggaatt
cctgcttatattgtggtgccccagacagctccagactgtaaaaaacttgcaatacaagcc
tacggagcgtcaattgtatactgtgaacctagtgatgagtccagagaaaatgttgcaaaa
agagttacagaagaaacagaaggcatcatggtacatcccaaccaggagcctgcagtgata
gctggacaagggacaattgccctggaagtgctgaaccaggttcctttggtggatgcactg
gtggtacctgtaggtggaggaggaatgcttgctggaatagcaattacagttaaggctctg
aaacctagtgtgaaggtatatgctgctgaaccctcaaatgcagatgactgctaccagtcc
aagctgaaggggaaactgatgcccaatctttatcctccagaaaccatagcagatggtgtc
aaatccagcattggcttgaacacctggcctattatcagggaccttgtggatgatatcttc
actgtcacagaggatgaaattaagtgtgcaacccagctggtgtgggagaggatgaaacta
ctcattgaacctacagctggtgttggagtggctgctgtgctgtctcaacattttcaaact
gtttccccagaagtaaagaacatttgtattgtgctcagtggtggaaatgtagacttaacc
tcctccataacttgggtgaagcaggctgaaaggccagcttcttatcagtctgtttctgtt
taa

DBGET integrated database retrieval system