KEGG   Homo sapiens (human): 6383Help
Entry
6383              CDS       T01001                                 

Gene name
SDC2, CD362, HSPG, HSPG1, SYND2
Definition
(RefSeq) syndecan 2
  KO
K16336  
syndecan 2
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Malaria
Proteoglycans in cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6383 (SDC2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6383 (SDC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6383 (SDC2)
  Infectious diseases
   05144 Malaria
    6383 (SDC2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     6383 (SDC2)
Cellular antigens [BR:hsa04090]
 Proteins
  6383 (SDC2)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6383 (SDC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P34741(Tbio)
UniProt: 
Position
8q22.1
AA seq 201 aa AA seqDB search
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEFYA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgcgtggatcctgctcaccttgggcttggtggcctgcgtgtcggcggagtcg
agagcagagctgacatctgataaagacatgtaccttgacaacagctccattgaagaagct
tcaggagtgtatcctattgatgacgatgactacgcttctgcgtctggctcgggagctgat
gaggatgtagagagtccagagctgacaacatctcgaccacttccaaagatactgttgact
agtgctgctccaaaagtggaaaccacgacgctgaatatacagaacaagatacctgctcag
acaaagtcacctgaagaaactgataaagagaaagttcacctctctgactcagaaaggaaa
atggacccagccgaagaggatacaaatgtgtatactgagaaacactcagacagtctgttt
aaacggacagaagtcctagcagctgtcattgctggtggagttattggctttctctttgca
atttttcttatcctgctgttggtgtatcgcatgagaaagaaggatgaaggaagctatgac
cttggagaacgcaaaccatccagtgctgcttatcagaaggcacctactaaggagttttat
gcgtaa

DBGET integrated database retrieval system