KEGG   Homo sapiens (human): 6385Help
Entry
6385              CDS       T01001                                 

Gene name
SDC4, SYND4
Definition
(RefSeq) syndecan 4
  KO
K16338  
syndecan 4
Organism
hsa  Homo sapiens (human)
Pathway
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Proteoglycans in cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    6385 (SDC4)
   04514 Cell adhesion molecules (CAMs)
    6385 (SDC4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6385 (SDC4)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6385 (SDC4)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    THY1, CD90; Thy-1 cell surface antigen [KO:K06514]
     6385 (SDC4)
 2. Integrin Family
  Beta1 integrins
   VLA-5
    ITGB1; integrin beta 1 [KO:K05719]
     6385 (SDC4)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     6385 (SDC4)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6385 (SDC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P31431(Tbio)
UniProt: 
Position
20q13.12
AA seq 198 aa AA seqDB search
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEFYA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgcccgtctgttcgcgctgctgctgttcttcgtaggcggagtcgccgagtcg
atccgagagactgaggtcatcgacccccaggacctcctagaaggccgatacttctccgga
gccctaccagacgatgaggatgtagtggggcccgggcaggaatctgatgactttgagctg
tctggctctggagatctggatgacttggaagactccatgatcggccctgaagttgtccat
cccttggtgcctctagataaccatatccctgagagggcagggtctgggagccaagtcccc
accgaacccaagaaactagaggagaatgaggttatccccaagagaatctcacccgttgaa
gagagtgaggatgtgtccaacaaggtgtcaatgtccagcactgtgcagggcagcaacatc
tttgagagaacggaggtcctggcagctctgattgtgggtggcatcgtgggcatcctcttt
gccgtcttcctgatcctactgctcatgtaccgtatgaagaagaaggatgaaggcagctat
gacctgggcaagaaacccatctacaagaaagcccccaccaatgagttctacgcgtga

DBGET integrated database retrieval system