KEGG   Homo sapiens (human): 6385Help
Entry
6385              CDS       T01001                                 

Gene name
SDC4, SYND4
Definition
syndecan 4
Orthology
K16338  
syndecan 4
Organism
hsa  Homo sapiens (human)
Pathway
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    6385 (SDC4)
   04514 Cell adhesion molecules (CAMs)
    6385 (SDC4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6385 (SDC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q12
AA seq 198 aa AA seqDB search
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEFYA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgcccgtctgttcgcgctgctgctgttcttcgtaggcggagtcgccgagtcg
atccgagagactgaggtcatcgacccccaggacctcctagaaggccgatacttctccgga
gccctaccagacgatgaggatgtagtggggcccgggcaggaatctgatgactttgagctg
tctggctctggagatctggatgacttggaagactccatgatcggccctgaagttgtccat
cccttggtgcctctagataaccatatccctgagagggcagggtctgggagccaagtcccc
accgaacccaagaaactagaggagaatgaggttatccccaagagaatctcacccgttgaa
gagagtgaggatgtgtccaacaaggtgtcaatgtccagcactgtgcagggcagcaacatc
tttgagagaacggaggtcctggcagctctgattgtgggtggcatcgtgggcatcctcttt
gccgtcttcctgatcctactgctcatgtaccgtatgaagaagaaggatgaaggcagctat
gacctgggcaagaaacccatctacaagaaagcccccaccaatgagttctacgcgtga

DBGET integrated database retrieval system