KEGG   Homo sapiens (human): 6387Help
Entry
6387              CDS       T01001                                 

Gene name
CXCL12, IRH, PBSF, SCYB12, SDF1, TLSF, TPAR1, SDF1A, SDF1B
Definition
(RefSeq) C-X-C motif chemokine ligand 12
  KO
K10031  C-X-C motif chemokine 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04360  Axon guidance
hsa04670  Leukocyte transendothelial migration
hsa04672  Intestinal immune network for IgA production
hsa05200  Pathways in cancer
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    6387 (CXCL12)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6387 (CXCL12)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    6387 (CXCL12)
   04672 Intestinal immune network for IgA production
    6387 (CXCL12)
   04062 Chemokine signaling pathway
    6387 (CXCL12)
  Development
   04360 Axon guidance
    6387 (CXCL12)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6387 (CXCL12)
  Immune diseases
   05323 Rheumatoid arthritis
    6387 (CXCL12)
Cytokines [BR:hsa04052]
 Chemokines
  CXC chemokine family
   6387 (CXCL12)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
   6387 (CXCL12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6387
NCBI-ProteinID: NP_000600
OMIM: 600835
HGNC: 10672
Ensembl: ENSG00000107562
Vega: OTTHUMG00000018054
Pharos: P48061(Tbio)
UniProt: P48061
Structure
PDB: 

Jmol
Position
10q11.21
AA seq 93 aa AA seqDB search
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta
gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system