KEGG   Homo sapiens (human): 6387Help
Entry
6387              CDS       T01001                                 

Gene name
CXCL12, IRH, PBSF, SCYB12, SDF1, TLSF, TPAR1, SDF1A, SDF1B
Definition
chemokine (C-X-C motif) ligand 12
Orthology
K10031  
C-X-C motif chemokine 12
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Axon guidance
Leukocyte transendothelial migration
Intestinal immune network for IgA production
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    6387 (CXCL12)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6387 (CXCL12)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    6387 (CXCL12)
   04672 Intestinal immune network for IgA production
    6387 (CXCL12)
   04062 Chemokine signaling pathway
    6387 (CXCL12)
  Development
   04360 Axon guidance
    6387 (CXCL12)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    6387 (CXCL12)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  6387 (CXCL12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q11.1
AA seq 93 aa AA seqDB search
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta
gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system