KEGG   Homo sapiens (human): 6387Help
Entry
6387              CDS       T01001                                 

Gene name
CXCL12, IRH, PBSF, SCYB12, SDF1, TLSF, TPAR1, SDF1A, SDF1B
Definition
chemokine (C-X-C motif) ligand 12
Orthology
K10031  
C-X-C motif chemokine 12
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Axon guidance
Leukocyte transendothelial migration
Intestinal immune network for IgA production
Rheumatoid arthritis
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q11.1
AA seq 93 aa AA seqDB search
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta
gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system