KEGG   Homo sapiens (human): 6401Help
Entry
6401              CDS       T01001                                 

Gene name
SELE, CD62E, ELAM, ELAM1, ESEL, LECAM2
Definition
(RefSeq) selectin E
  KO
K06494  
selectin, endothelial cell
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
African trypanosomiasis
Malaria
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6401 (SELE)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6401 (SELE)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    6401 (SELE)
  Infectious diseases
   05144 Malaria
    6401 (SELE)
   05143 African trypanosomiasis
    6401 (SELE)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   CEACAM; carcinoembryonic antigen-related cell adhesion molecule [KO:K06499]
    6401 (SELE)
 2. Integrin Family
  Beta2 integrins
   CR3, Mac-1
    ITGB2; integrin beta 2 [KO:K06464]
     6401 (SELE)
 3. Selectin Family
  SELL; selectin, lymphocyte [KO:K06495]
   6401 (SELE)
 4. Link Protein Family
  CD44; CD44 antigen [KO:K06256]
   6401 (SELE)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   6401 (SELE)
  SPN, CD43; sialophorin [KO:K06477]
   6401 (SELE)
  SELPLG; selectin P ligand [KO:K06544]
   6401 (SELE)
  PODXL2; podocalyxin-like 2 [KO:K06818]
   6401 (SELE)
Cellular antigens [BR:hsa04090]
 Proteins
  6401 (SELE)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 4: Selectins
   6401 (SELE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q24.2
AA seq 610 aa AA seqDB search
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttcacagtttctctcagctctcactttggtgcttctcattaaagagagtgga
gcctggtcttacaacacctccacggaagctatgacttatgatgaggccagtgcttattgt
cagcaaaggtacacacacctggttgcaattcaaaacaaagaagagattgagtacctaaac
tccatattgagctattcaccaagttattactggattggaatcagaaaagtcaacaatgtg
tgggtctgggtaggaacccagaaacctctgacagaagaagccaagaactgggctccaggt
gaacccaacaataggcaaaaagatgaggactgcgtggagatctacatcaagagagaaaaa
gatgtgggcatgtggaatgatgagaggtgcagcaagaagaagcttgccctatgctacaca
gctgcctgtaccaatacatcctgcagtggccacggtgaatgtgtagagaccatcaataat
tacacttgcaagtgtgaccctggcttcagtggactcaagtgtgagcaaattgtgaactgt
acagccctggaatcccctgagcatggaagcctggtttgcagtcacccactgggaaacttc
agctacaattcttcctgctctatcagctgtgataggggttacctgccaagcagcatggag
accatgcagtgtatgtcctctggagaatggagtgctcctattccagcctgcaatgtggtt
gagtgtgatgctgtgacaaatccagccaatgggttcgtggaatgtttccaaaaccctgga
agcttcccatggaacacaacctgtacatttgactgtgaagaaggatttgaactaatggga
gcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaacgtgtaaa
gctgtgacatgcagggccgtccgccagcctcagaatggctctgtgaggtgcagccattcc
cctgctggagagttcaccttcaaatcatcctgcaacttcacctgtgaggaaggcttcatg
ttgcagggaccagcccaggttgaatgcaccactcaagggcagtggacacagcaaatccca
gtttgtgaagctttccagtgcacagccttgtccaaccccgagcgaggctacatgaattgt
cttcctagtgcttctggcagtttccgttatgggtccagctgtgagttctcctgtgagcag
ggttttgtgttgaagggatccaaaaggctccaatgtggccccacaggggagtgggacaac
gagaagcccacatgtgaagctgtgagatgcgatgctgtccaccagcccccgaagggtttg
gtgaggtgtgctcattcccctattggagaattcacctacaagtcctcttgtgccttcagc
tgtgaggagggatttgaattacatggatcaactcaacttgagtgcacatctcagggacaa
tggacagaagaggttccttcctgccaagtggtaaaatgttcaagcctggcagttccggga
aagatcaacatgagctgcagtggggagcccgtgtttggcactgtgtgcaagttcgcctgt
cctgaaggatggacgctcaatggctctgcagctcggacatgtggagccacaggacactgg
tctggcctgctacctacctgtgaagctcccactgagtccaacattcccttggtagctgga
ctttctgctgctggactctccctcctgacattagcaccatttctcctctggcttcggaaa
tgcttacggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagat
ggaagctaccaaaagccttcttacatcctttaa

DBGET integrated database retrieval system