KEGG   Homo sapiens (human): 6401Help
Entry
6401              CDS       T01001                                 

Gene name
SELE, CD62E, ELAM, ELAM1, ESEL, LECAM2
Definition
selectin E
Orthology
K06494  
selectin, endothelial cell
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
TNF signaling pathway
African trypanosomiasis
Malaria
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6401 (SELE)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6401 (SELE)
 Human Diseases
  Infectious diseases
   05144 Malaria
    6401 (SELE)
   05143 African trypanosomiasis
    6401 (SELE)
Cellular antigens [BR:hsa04090]
 Proteins
  6401 (SELE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q22-q25
AA seq 610 aa AA seqDB search
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttcacagtttctctcagctctcactttggtgcttctcattaaagagagtgga
gcctggtcttacaacacctccacggaagctatgacttatgatgaggccagtgcttattgt
cagcaaaggtacacacacctggttgcaattcaaaacaaagaagagattgagtacctaaac
tccatattgagctattcaccaagttattactggattggaatcagaaaagtcaacaatgtg
tgggtctgggtaggaacccagaaacctctgacagaagaagccaagaactgggctccaggt
gaacccaacaataggcaaaaagatgaggactgcgtggagatctacatcaagagagaaaaa
gatgtgggcatgtggaatgatgagaggtgcagcaagaagaagcttgccctatgctacaca
gctgcctgtaccaatacatcctgcagtggccacggtgaatgtgtagagaccatcaataat
tacacttgcaagtgtgaccctggcttcagtggactcaagtgtgagcaaattgtgaactgt
acagccctggaatcccctgagcatggaagcctggtttgcagtcacccactgggaaacttc
agctacaattcttcctgctctatcagctgtgataggggttacctgccaagcagcatggag
accatgcagtgtatgtcctctggagaatggagtgctcctattccagcctgcaatgtggtt
gagtgtgatgctgtgacaaatccagccaatgggttcgtggaatgtttccaaaaccctgga
agcttcccatggaacacaacctgtacatttgactgtgaagaaggatttgaactaatggga
gcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaacgtgtaaa
gctgtgacatgcagggccgtccgccagcctcagaatggctctgtgaggtgcagccattcc
cctgctggagagttcaccttcaaatcatcctgcaacttcacctgtgaggaaggcttcatg
ttgcagggaccagcccaggttgaatgcaccactcaagggcagtggacacagcaaatccca
gtttgtgaagctttccagtgcacagccttgtccaaccccgagcgaggctacatgaattgt
cttcctagtgcttctggcagtttccgttatgggtccagctgtgagttctcctgtgagcag
ggttttgtgttgaagggatccaaaaggctccaatgtggccccacaggggagtgggacaac
gagaagcccacatgtgaagctgtgagatgcgatgctgtccaccagcccccgaagggtttg
gtgaggtgtgctcattcccctattggagaattcacctacaagtcctcttgtgccttcagc
tgtgaggagggatttgaattacatggatcaactcaacttgagtgcacatctcagggacaa
tggacagaagaggttccttcctgccaagtggtaaaatgttcaagcctggcagttccggga
aagatcaacatgagctgcagtggggagcccgtgtttggcactgtgtgcaagttcgcctgt
cctgaaggatggacgctcaatggctctgcagctcggacatgtggagccacaggacactgg
tctggcctgctacctacctgtgaagctcccactgagtccaacattcccttggtagctgga
ctttctgctgctggactctccctcctgacattagcaccatttctcctctggcttcggaaa
tgcttacggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagat
ggaagctaccaaaagccttcttacatcctttaa

DBGET integrated database retrieval system