KEGG   Homo sapiens (human): 6401Help
Entry
6401              CDS       T01001                                 

Gene name
SELE, CD62E, ELAM, ELAM1, ESEL, LECAM2
Definition
(RefSeq) selectin E
  KO
K06494  
selectin, endothelial cell
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
African trypanosomiasis
Malaria
Fluid shear stress and atherosclerosis
Drug target
Rivipansel: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6401 (SELE)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6401 (SELE)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6401 (SELE)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    6401 (SELE)
  Infectious diseases
   05144 Malaria
    6401 (SELE)
   05143 African trypanosomiasis
    6401 (SELE)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   CEACAM; carcinoembryonic antigen-related cell adhesion molecule [KO:K06499]
    6401 (SELE)
 2. Integrin Family
  Beta2 integrins
   CR3, Mac-1
    ITGB2; integrin beta 2 [KO:K06464]
     6401 (SELE)
 3. Selectin Family
  SELL; selectin, lymphocyte [KO:K06495]
   6401 (SELE)
 4. Link Protein Family
  CD44; CD44 antigen [KO:K06256]
   6401 (SELE)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   6401 (SELE)
  SPN, CD43; sialophorin [KO:K06477]
   6401 (SELE)
  SELPLG; selectin P ligand [KO:K06544]
   6401 (SELE)
  PODXL2; podocalyxin-like 2 [KO:K06818]
   6401 (SELE)
CD molecules [BR:hsa04090]
 Proteins
  6401 (SELE)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 4: Selectins
   6401 (SELE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P16581(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
1q24.2
AA seq 610 aa AA seqDB search
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttcacagtttctctcagctctcactttggtgcttctcattaaagagagtgga
gcctggtcttacaacacctccacggaagctatgacttatgatgaggccagtgcttattgt
cagcaaaggtacacacacctggttgcaattcaaaacaaagaagagattgagtacctaaac
tccatattgagctattcaccaagttattactggattggaatcagaaaagtcaacaatgtg
tgggtctgggtaggaacccagaaacctctgacagaagaagccaagaactgggctccaggt
gaacccaacaataggcaaaaagatgaggactgcgtggagatctacatcaagagagaaaaa
gatgtgggcatgtggaatgatgagaggtgcagcaagaagaagcttgccctatgctacaca
gctgcctgtaccaatacatcctgcagtggccacggtgaatgtgtagagaccatcaataat
tacacttgcaagtgtgaccctggcttcagtggactcaagtgtgagcaaattgtgaactgt
acagccctggaatcccctgagcatggaagcctggtttgcagtcacccactgggaaacttc
agctacaattcttcctgctctatcagctgtgataggggttacctgccaagcagcatggag
accatgcagtgtatgtcctctggagaatggagtgctcctattccagcctgcaatgtggtt
gagtgtgatgctgtgacaaatccagccaatgggttcgtggaatgtttccaaaaccctgga
agcttcccatggaacacaacctgtacatttgactgtgaagaaggatttgaactaatggga
gcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaacgtgtaaa
gctgtgacatgcagggccgtccgccagcctcagaatggctctgtgaggtgcagccattcc
cctgctggagagttcaccttcaaatcatcctgcaacttcacctgtgaggaaggcttcatg
ttgcagggaccagcccaggttgaatgcaccactcaagggcagtggacacagcaaatccca
gtttgtgaagctttccagtgcacagccttgtccaaccccgagcgaggctacatgaattgt
cttcctagtgcttctggcagtttccgttatgggtccagctgtgagttctcctgtgagcag
ggttttgtgttgaagggatccaaaaggctccaatgtggccccacaggggagtgggacaac
gagaagcccacatgtgaagctgtgagatgcgatgctgtccaccagcccccgaagggtttg
gtgaggtgtgctcattcccctattggagaattcacctacaagtcctcttgtgccttcagc
tgtgaggagggatttgaattacatggatcaactcaacttgagtgcacatctcagggacaa
tggacagaagaggttccttcctgccaagtggtaaaatgttcaagcctggcagttccggga
aagatcaacatgagctgcagtggggagcccgtgtttggcactgtgtgcaagttcgcctgt
cctgaaggatggacgctcaatggctctgcagctcggacatgtggagccacaggacactgg
tctggcctgctacctacctgtgaagctcccactgagtccaacattcccttggtagctgga
ctttctgctgctggactctccctcctgacattagcaccatttctcctctggcttcggaaa
tgcttacggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagat
ggaagctaccaaaagccttcttacatcctttaa

DBGET integrated database retrieval system