KEGG   Homo sapiens (human): 6401Help
Entry
6401              CDS       T01001                                 

Gene name
SELE, CD62E, ELAM, ELAM1, ESEL, LECAM2
Definition
selectin E
Orthology
K06494  
selectin, endothelial cell
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
TNF signaling pathway
African trypanosomiasis
Malaria
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q22-q25
AA seq 610 aa AA seqDB search
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttcacagtttctctcagctctcactttggtgcttctcattaaagagagtgga
gcctggtcttacaacacctccacggaagctatgacttatgatgaggccagtgcttattgt
cagcaaaggtacacacacctggttgcaattcaaaacaaagaagagattgagtacctaaac
tccatattgagctattcaccaagttattactggattggaatcagaaaagtcaacaatgtg
tgggtctgggtaggaacccagaaacctctgacagaagaagccaagaactgggctccaggt
gaacccaacaataggcaaaaagatgaggactgcgtggagatctacatcaagagagaaaaa
gatgtgggcatgtggaatgatgagaggtgcagcaagaagaagcttgccctatgctacaca
gctgcctgtaccaatacatcctgcagtggccacggtgaatgtgtagagaccatcaataat
tacacttgcaagtgtgaccctggcttcagtggactcaagtgtgagcaaattgtgaactgt
acagccctggaatcccctgagcatggaagcctggtttgcagtcacccactgggaaacttc
agctacaattcttcctgctctatcagctgtgataggggttacctgccaagcagcatggag
accatgcagtgtatgtcctctggagaatggagtgctcctattccagcctgcaatgtggtt
gagtgtgatgctgtgacaaatccagccaatgggttcgtggaatgtttccaaaaccctgga
agcttcccatggaacacaacctgtacatttgactgtgaagaaggatttgaactaatggga
gcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaacgtgtaaa
gctgtgacatgcagggccgtccgccagcctcagaatggctctgtgaggtgcagccattcc
cctgctggagagttcaccttcaaatcatcctgcaacttcacctgtgaggaaggcttcatg
ttgcagggaccagcccaggttgaatgcaccactcaagggcagtggacacagcaaatccca
gtttgtgaagctttccagtgcacagccttgtccaaccccgagcgaggctacatgaattgt
cttcctagtgcttctggcagtttccgttatgggtccagctgtgagttctcctgtgagcag
ggttttgtgttgaagggatccaaaaggctccaatgtggccccacaggggagtgggacaac
gagaagcccacatgtgaagctgtgagatgcgatgctgtccaccagcccccgaagggtttg
gtgaggtgtgctcattcccctattggagaattcacctacaagtcctcttgtgccttcagc
tgtgaggagggatttgaattacatggatcaactcaacttgagtgcacatctcagggacaa
tggacagaagaggttccttcctgccaagtggtaaaatgttcaagcctggcagttccggga
aagatcaacatgagctgcagtggggagcccgtgtttggcactgtgtgcaagttcgcctgt
cctgaaggatggacgctcaatggctctgcagctcggacatgtggagccacaggacactgg
tctggcctgctacctacctgtgaagctcccactgagtccaacattcccttggtagctgga
ctttctgctgctggactctccctcctgacattagcaccatttctcctctggcttcggaaa
tgcttacggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagat
ggaagctaccaaaagccttcttacatcctttaa

DBGET integrated database retrieval system