KEGG   Homo sapiens (human): 6403Help
Entry
6403              CDS       T01001                                 

Gene name
SELP, CD62, CD62P, GMP140, GRMP, LECAM3, PADGEM, PSEL
Definition
(RefSeq) selectin P
  KO
K06496  
selectin, platele
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Malaria
Staphylococcus aureus infection
Drug target
Inclacumab: 
Torapsel: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6403 (SELP)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    6403 (SELP)
   05144 Malaria
    6403 (SELP)
Cell adhesion molecules and their ligands [BR:hsa04516]
 6. Sialomucin Family
  SELPLG; selectin P ligand [KO:K06544]
   6403 (SELP)
  PODXL2; podocalyxin-like 2 [KO:K06818]
   6403 (SELP)
Cellular antigens [BR:hsa04090]
 Proteins
  6403 (SELP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
   6403 (SELP)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 4: Selectins
   6403 (SELP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q24.2
AA seq 830 aa AA seqDB search
MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC
DEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA
STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggccaactgccaaatagccatcttgtaccagagattccagagagtggtctttggaatt
tcccaactcctttgcttcagtgccctgatctctgaactaacaaaccagaaagaagtggca
gcatggacttatcattacagcacaaaagcatactcatggaatatttcccgtaaatactgc
cagaatcgctacacagacttagtggccatccagaataaaaatgaaattgattacctcaat
aaggtcctaccctactacagctcctactactggattgggatccgaaagaacaataagaca
tggacatgggtgggaaccaaaaaggctctcaccaacgaggctgagaactgggctgataat
gaacctaacaacaaaaggaacaacgaggactgcgtggagatatacatcaagagtccgtca
gcccctggcaagtggaatgatgagcactgcttgaagaaaaagcacgcattgtgttacaca
gcctcctgccaggacatgtcctgcagcaaacaaggagagtgcctcgagaccatcgggaac
tacacctgctcctgttaccctggattctatgggccagaatgtgaatacgtgagagagtgt
ggagaacttgagctccctcaacacgtgctcatgaactgcagccaccctctgggaaacttc
tcttttaactcgcagtgcagcttccactgcactgacgggtaccaagtaaatgggcccagc
aagctggaatgcttggcttctggaatctggacaaataagcctccacagtgtttagctgcc
cagtgcccacccctgaagattcctgaacgaggaaacatgacctgccttcattctgcaaaa
gcattccagcatcagtctagctgcagcttcagttgtgaagagggatttgcattagttgga
ccggaagtggtgcaatgcacagcctcgggggtatggacagccccagccccagtgtgtaaa
gctgtgcagtgtcagcacctggaagcccccagtgaaggaaccatggactgtgttcatccg
ctcactgcttttgcctatggctccagctgtaaatttgagtgccagcccggctacagagtg
aggggcttggacatgctccgctgcattgactctggacactggtctgcacccttgccaacc
tgtgaggctatttcgtgtgagccgctggagagtcctgtccacggaagcatggattgctct
ccatccttgagagcgtttcagtatgacaccaactgtagcttccgctgtgctgaaggtttc
atgctgagaggagccgatatagttcggtgtgataacttgggacagtggacagcaccagcc
ccagtctgtcaagctttgcagtgccaggatctcccagttccaaatgaggcccgggtgaac
tgctcccaccccttcggtgcctttaggtaccagtcagtctgcagcttcacctgcaatgaa
ggcttgctcctggtgggagcaagtgtgctacagtgcttggctactggaaactggaattct
gttcctccagaatgccaagccattccctgcacacctttgctaagccctcagaatggaaca
atgacctgtgttcaacctcttggaagttccagttataaatccacatgtcaattcatctgt
gacgagggatattctttgtctggaccagaaagattggattgtactcgatcgggacgctgg
acagactccccaccaatgtgtgaagccatcaagtgcccagaactctttgccccagagcag
ggcagcctggattgttctgacactcgtggagaattcaatgttggctccacctgccatttc
tcttgtgacaacggctttaagctggaggggcccaataatgtggaatgcacaacttctgga
agatggtcagctactccaccaacctgcaaaggcatagcatcacttcctactccaggggtg
caatgtccagccctcaccactcctgggcagggaaccatgtactgtaggcatcatccggga
acctttggttttaataccacttgttactttggctgcaacgctggattcacactcatagga
gacagcactctcagctgcagaccttcaggacaatggacagcagtaactccagcatgcaga
gctgtgaaatgctcagaactacatgttaataagccaatagcgatgaactgctccaacctc
tggggaaacttcagttatggatcaatctgctctttccattgtctagagggccagttactt
aatggctctgcacaaacagcatgccaagagaatggccactggtcaactaccgtgccaacc
tgccaagcaggaccattgactatccaggaagccctgacttactttggtggagcggtggct
tctacgataggtctgataatgggtgggacgctcctggctttgctaagaaagcgtttcaga
caaaaagatgatgggaaatgccccttgaatcctcacagccacctaggaacatatggagtt
tttacaaacgctgcatttgacccgagtccttaa

DBGET integrated database retrieval system