KEGG   Homo sapiens (human): 64067Help
Entry
64067             CDS       T01001                                 

Gene name
NPAS3, MOP6, PASD6, bHLHe12
Definition
(RefSeq) neuronal PAS domain protein 3
  KO
K09098  
neuronal PAS domain-containing protein 1/3
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    64067 (NPAS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q13.1
AA seq 933 aa AA seqDB search
MAPTKPSFQQDPSRRERITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAA
RSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEG
PPPNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSI
YLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSE
TPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSH
GRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVD
IVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKN
ANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNEN
SKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENP
KAGEDGFGALGAMQIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKR
KKRRKRQKGGSASRRRLSSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDN
DSSIWNYPPNREISRNESPYSMTKPPSSEHFPSPQGGGGGGGGGGGLHVAIPDSVLTPPG
ADGAAARKTQFGASATAALAPVASDPLSPPLSASPRDKHPGNGGGGGGGGGGAGGGGPSA
SNSLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAM
QSNLLPNAHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAG
NVFTTAEGLFSTLPFPVYSNGIHAAQTLERKED
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaccaagcccagctttcagcaggatccttccaggcgagaacgaataactgcc
cagcatcctctgcccaaccaatcagaatgtaggaaaatctacagatatgacggaatctac
tgtgaatctacctaccagaatttacaagcattgagaaaggagaaatcccgagatgctgct
cgctcccgccggggaaaagaaaactttgagttctatgaattggccaagttgttgcctctt
cctgcagccattaccagccagctcgacaaggcatccatcattcgacttacaattagctat
ctgaaaatgagggactttgctaaccagggggaccctccgtggaacttgcgaatggaaggc
cctccacctaacacatcagtaaaagttataggtgcacagcgaaggagaagccccagtgca
ctagccattgaagtatttgaagcacatttgggaagccacattttgcagtccctggatggc
tttgtatttgcactaaatcaggaaggaaaatttttgtacatttccgaaacagtctccatc
tacctaggcctctcacaagtggagctgacaggcagcagtgtctttgactatgtccacccc
ggagatcacgtggagatggctgagcagctgggcatgaagctcccccctgggcggggtctc
ctgtcacagggcactgctgaggacggagccagctcagcatcttcctcctctcagtcggag
acccccgagccagtggagtcaaccagccccagtctgctaaccactgacaacactcttgag
cgttcctttttcatccgaatgaaatctactctgaccaaacgcggtgtgcacatcaaatca
tcaggatataaggtgattcacataacaggccggctacgcctgagagtgtcgctgtcccac
gggaggaccgtccccagccaaatcatgggtctcgtggttgttgcgcatgccttgcctccc
cctacgatcaatgaagtcagaattgactgccatatgttcgtcactcgagtaaatatggac
ctcaatatcatttactgtgaaaataggattagtgattatatggatctgacccctgtagat
atcgtagggaagagatgctaccacttcatccatgctgaagacgtggagggcatcaggcac
agtcacttggacttgctgaataagggtcagtgtgtgacaaagtactatcgctggatgcag
aagaacggaggatatatttggatacagtccagtgccaccatagctattaatgccaagaat
gcaaatgaaaagaatatcatctgggtgaattaccttcttagcaatcctgagtacaaggac
acacccatggacatcgcacagctcccccatctgccggagaaaacttccgaatcctcggag
acatccgactctgagtcagactctaaagacacctcaggtattacagaggacaacgagaac
tccaagtccgacgagaaggggaaccagtccgagaacagcgaagacccggagcccgaccgg
aagaagtcgggcaacgcgtgtgacaacgacatgaactgcaacgacgacggccacagctcc
agtaacccggacagccgcgacagcgacgacagcttcgagcactcggactttgagaacccc
aaggcgggcgaggacggcttcggtgctctgggcgcgatgcagatcaaggtggagcgctac
gtggagagcgagtcggacctgcggctgcagaactgcgagtcactcacgtccgacagcgcc
aaggactcggacagcgcaggcgaggcgggcgcgcaggcctccagcaagcaccagaagcgc
aagaaaaggcggaaacggcaaaagggcggcagcgccagccgccggcgcctgtccagcgcg
tcgagcccaggcggcctggacgcgggcctggtggagcccccgcggctgctgtcctccccc
aacagtgcctcggtgctcaagatcaagacggagatctcagaacccatcaatttcgacaat
gacagcagcatctggaactacccgcccaaccgggagatctccaggaacgagtccccctac
agcatgaccaagccccccagctctgagcacttcccgtccccgcagggcggcggcggtggg
ggtggcggtggcggggggctgcacgtggccattcccgactcggtcctcaccccgcccggc
gccgacggcgcggccgcccgcaagactcagttcggcgcctcggccaccgcggccctggcc
cccgtcgcctccgacccgctgtcacccccgctctcggcgtccccgcgggacaagcacccc
gggaacggcggcgggggcgggggcgggggcggcggcgcggggggcggcggccccagcgcg
tccaactccttgctgtacactggggacctggaggcgctgcagaggttgcaggcgggcaac
gtcgtgctcccgctggtgcacagggtgaccgggaccctggccgccaccagcacggccgcg
cagagggtctacaccacgggcaccatccgctacgcgcccgccgaggtgaccctggccatg
cagagcaacctgctgcccaacgcgcacgctgttaacttcgtggacgttaacagccccggc
tttggcctcgaccccaagacgcccatggagatgctctaccaccacgtgcaccggctcaac
atgtcaggaccgttcggcggcgcagtgagcgcagctagcctgacgcagatgcccgccggc
aacgtgttcaccacggccgagggactcttctccacgctgcccttccccgtctacagcaac
ggcatccacgcggcacagactctggagcgcaaggaggactga

DBGET integrated database retrieval system