KEGG   Homo sapiens (human): 6422Help
Entry
6422              CDS       T01001                                 

Gene name
SFRP1, FRP, FRP-1, FRP1, FrzA, SARP2
Definition
secreted frizzled-related protein 1
Orthology
K02166  
secreted frizzled-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6422 (SFRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.21
AA seq 314 aa AA seqDB search
MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgggcgcagcgaggggggccgccgcggggcagccctgggcgtgctgctggcg
ctgggcgcggcgcttctggccgtgggctcggccagcgagtacgactacgtgagcttccag
tcggacatcggcccgtaccagagcgggcgcttctacaccaagccacctcagtgcgtggac
atccccgcggacctgcggctgtgccacaacgtgggctacaagaagatggtgctgcccaac
ctgctggagcacgagaccatggcggaggtgaagcagcaggccagcagctgggtgcccctg
ctcaacaagaactgccacgccggcacccaggtcttcctctgctcgctcttcgcgcccgtc
tgcctggaccggcccatctacccgtgtcgctggctctgcgaggccgtgcgcgactcgtgc
gagccggtcatgcagttcttcggcttctactggcccgagatgcttaagtgtgacaagttc
cccgagggggacgtctgcatcgccatgacgccgcccaatgccaccgaagcctccaagccc
caaggcacaacggtgtgtcctccctgtgacaacgagttgaaatctgaggccatcattgaa
catctctgtgccagcgagtttgcactgaggatgaaaataaaagaagtgaaaaaagaaaat
ggcgacaagaagattgtccccaagaagaagaagcccctgaagttggggcccatcaagaag
aaggacctgaagaagcttgtgctgtacctgaagaatggggctgactgtccctgccaccag
ctggacaacctcagccaccacttcctcatcatgggccgcaaggtgaagagccagtacttg
ctgacggccatccacaagtgggacaagaaaaacaaggagttcaaaaacttcatgaagaaa
atgaaaaaccatgagtgccccacctttcagtccgtgtttaagtga

DBGET integrated database retrieval system