KEGG   Homo sapiens (human): 64241Help
Entry
64241             CDS       T01001                                 

Gene name
ABCG8, GBD4, STSL
Definition
ATP-binding cassette, sub-family G (WHITE), member 8
Orthology
K05684  
ATP-binding cassette, subfamily G (WHITE), member 8 (sterolin 2)
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Fat digestion and absorption
Bile secretion
Disease
H00152  
Sitosterolemia
H01213  
Gallbladder disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    64241 (ABCG8)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    64241 (ABCG8)
   04975 Fat digestion and absorption
    64241 (ABCG8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p21
AA seq 673 aa AA seqDB search
MAGKAAEERGLPKGATPQDTSGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLAS
QVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITG
RGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFS
QAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPT
SGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHM
VQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFL
WKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLPTLLIH
GAEACLMSMTIGFLYFGHGSIQLSFMDTAALLFMIGALIPFNVILDVISKCYSERAMLYY
ELEDGLYTTGPYFFAKILGELPEHCAYIIIYGMPTYWLANLRPGLQPFLLHFLLVWLVVF
CCRIMALAAAALLPTFHMASFFSNALYNSFYLAGGFMINLSSLWTVPAWISKVSFLRWCF
EGLMKIQFSRRTYKMPLGNLTIAVSGDKILSVMELDSYPLYAIYLIVIGLSGGFMVLYYV
SLRFIKQKPSQDW
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaggcggcagaggagagagggctgccgaaaggggccactccccaggatacc
tcgggcctccaggatagattgttctcctctgaaagtgacaacagcctgtacttcacctac
agtggccagcccaacaccctggaggtcagagacctcaactaccaggtggacctggcctct
caggtcccttggtttgagcagctggctcagttcaagatgccctggacatctcccagctgc
cagaattcttgtgagctgggcatccagaacctaagcttcaaagtgagaagtgggcagatg
ctggccatcatagggagctcaggttgtgggagagcctccttgctagatgtgatcactggc
cgaggtcacggcggcaagatcaagtcaggccagatctggatcaatgggcagcccagctcg
cctcagctggtgaggaagtgtgtggcccacgtgcgccagcacaaccagctgctccccaac
ttgactgtgcgagagaccttggccttcattgcccagatgcggctgcccagaaccttctcc
caggcccagcgtgacaaaagggtggaggacgtgatcgcggagctgcggcttaggcagtgc
gctgacacccgcgtgggcaacatgtacgtgcgggggttgtcggggggtgagcgcaggaga
gtcagcattggggtgcagctcctgtggaacccaggaatccttattctcgacgaacccacc
tctgggctcgacagcttcacagcccacaacctggtgaagaccttgtccaggctggccaaa
ggcaaccggctggtgctcatctccctccaccagcctcgctctgacatcttcaggctgttt
gatctggtcctcctgatgacgtctggcacccccatctacttaggggcggcccagcacatg
gtccagtatttcacagccatcggctacccctgtcctcgctacagcaatcctgctgacttc
tatgtggacctgaccagcattgacaggcgcagcagagagcaggaattggccaccagggag
aaggctcagtcactcgcagccctgtttctagaaaaagtgcgtgacttagatgactttcta
tggaaagcagagacgaaggatcttgacgaggacacctgtgtggaaagcagcgtgacccca
ctagacaccaactgcctcccgagtcctacgaagatgcctggggcggtgcagcagtttacg
acgctgatccgtcgtcagatttccaacgacttccgagacctgcccaccctcctcatccat
ggggcggaggcctgtctgatgtcaatgaccatcggcttcctctattttggccatgggagc
atccagctctccttcatggatacagccgccctcttgttcatgatcggtgctctcatccct
ttcaacgtcattctggatgtcatctccaaatgttactcagagagggcaatgctttactat
gaactggaagacgggctgtacaccactggtccatatttctttgccaagatcctcggggag
cttccggagcactgtgcctacatcatcatctacgggatgcccacctactggctggccaac
ctgaggccaggcctccagcccttcctgctgcacttcctgctggtgtggctggtggtcttc
tgttgcaggattatggccctggccgccgcggccctgctccccaccttccacatggcctcc
ttcttcagcaatgccctctacaactccttctacctcgccgggggcttcatgataaacttg
agcagcctgtggacagtgcccgcgtggatttccaaagtgtccttcctgcggtggtgtttt
gaagggctgatgaagattcagttcagcagaagaacttataaaatgcctctcgggaacctc
accatcgcggtctcaggagataaaatcctcagtgtcatggagctggactcgtaccctctc
tacgccatctacctcatcgtcattggcctcagcggtggcttcatggtcctgtactacgtg
tccttaaggttcatcaaacagaaaccaagtcaagactggtga

DBGET integrated database retrieval system