KEGG   Homo sapiens (human): 64241Help
Entry
64241             CDS       T01001                                 

Gene name
ABCG8, GBD4, STSL
Definition
(RefSeq) ATP binding cassette subfamily G member 8
  KO
K05684  
ATP-binding cassette, subfamily G (WHITE), member 8 (sterolin 2)
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Fat digestion and absorption
Bile secretion
Disease
H00152  
Sitosterolemia
H01213  
Gallbladder disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    64241 (ABCG8)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    64241 (ABCG8)
   04975 Fat digestion and absorption
    64241 (ABCG8)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCG (White) subfamily
   ABCG5, 8 subgroups
    64241 (ABCG8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p21
AA seq 673 aa AA seqDB search
MAGKAAEERGLPKGATPQDTSGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLAS
QVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITG
RGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFS
QAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPT
SGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHM
VQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFL
WKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLPTLLIH
GAEACLMSMTIGFLYFGHGSIQLSFMDTAALLFMIGALIPFNVILDVISKCYSERAMLYY
ELEDGLYTTGPYFFAKILGELPEHCAYIIIYGMPTYWLANLRPGLQPFLLHFLLVWLVVF
CCRIMALAAAALLPTFHMASFFSNALYNSFYLAGGFMINLSSLWTVPAWISKVSFLRWCF
EGLMKIQFSRRTYKMPLGNLTIAVSGDKILSVMELDSYPLYAIYLIVIGLSGGFMVLYYV
SLRFIKQKPSQDW
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaggcggcagaggagagagggctgccgaaaggggccactccccaggatacc
tcgggcctccaggatagattgttctcctctgaaagtgacaacagcctgtacttcacctac
agtggccagcccaacaccctggaggtcagagacctcaactaccaggtggacctggcctct
caggtcccttggtttgagcagctggctcagttcaagatgccctggacatctcccagctgc
cagaattcttgtgagctgggcatccagaacctaagcttcaaagtgagaagtgggcagatg
ctggccatcatagggagctcaggttgtgggagagcctccttgctagatgtgatcactggc
cgaggtcacggcggcaagatcaagtcaggccagatctggatcaatgggcagcccagctcg
cctcagctggtgaggaagtgtgtggcccacgtgcgccagcacaaccagctgctccccaac
ttgactgtgcgagagaccttggccttcattgcccagatgcggctgcccagaaccttctcc
caggcccagcgtgacaaaagggtggaggacgtgatcgcggagctgcggcttaggcagtgc
gctgacacccgcgtgggcaacatgtacgtgcgggggttgtcggggggtgagcgcaggaga
gtcagcattggggtgcagctcctgtggaacccaggaatccttattctcgacgaacccacc
tctgggctcgacagcttcacagcccacaacctggtgaagaccttgtccaggctggccaaa
ggcaaccggctggtgctcatctccctccaccagcctcgctctgacatcttcaggctgttt
gatctggtcctcctgatgacgtctggcacccccatctacttaggggcggcccagcacatg
gtccagtatttcacagccatcggctacccctgtcctcgctacagcaatcctgctgacttc
tatgtggacctgaccagcattgacaggcgcagcagagagcaggaattggccaccagggag
aaggctcagtcactcgcagccctgtttctagaaaaagtgcgtgacttagatgactttcta
tggaaagcagagacgaaggatcttgacgaggacacctgtgtggaaagcagcgtgacccca
ctagacaccaactgcctcccgagtcctacgaagatgcctggggcggtgcagcagtttacg
acgctgatccgtcgtcagatttccaacgacttccgagacctgcccaccctcctcatccat
ggggcggaggcctgtctgatgtcaatgaccatcggcttcctctattttggccatgggagc
atccagctctccttcatggatacagccgccctcttgttcatgatcggtgctctcatccct
ttcaacgtcattctggatgtcatctccaaatgttactcagagagggcaatgctttactat
gaactggaagacgggctgtacaccactggtccatatttctttgccaagatcctcggggag
cttccggagcactgtgcctacatcatcatctacgggatgcccacctactggctggccaac
ctgaggccaggcctccagcccttcctgctgcacttcctgctggtgtggctggtggtcttc
tgttgcaggattatggccctggccgccgcggccctgctccccaccttccacatggcctcc
ttcttcagcaatgccctctacaactccttctacctcgccgggggcttcatgataaacttg
agcagcctgtggacagtgcccgcgtggatttccaaagtgtccttcctgcggtggtgtttt
gaagggctgatgaagattcagttcagcagaagaacttataaaatgcctctcgggaacctc
accatcgcggtctcaggagataaaatcctcagtgtcatggagctggactcgtaccctctc
tacgccatctacctcatcgtcattggcctcagcggtggcttcatggtcctgtactacgtg
tccttaaggttcatcaaacagaaaccaagtcaagactggtga

DBGET integrated database retrieval system