KEGG   Homo sapiens (human): 6464Help
Entry
6464              CDS       T01001                                 

Gene name
SHC1, SHC, SHCA
Definition
(RefSeq) SHC (Src homology 2 domain containing) transforming protein 1
  KO
K06279  
SHC-transforming protein 1
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Insulin signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Bacterial invasion of epithelial cells
MicroRNAs in cancer
Glioma
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    6464 (SHC1)
   04012 ErbB signaling pathway
    6464 (SHC1)
   04072 Phospholipase D signaling pathway
    6464 (SHC1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    6464 (SHC1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    6464 (SHC1)
   04062 Chemokine signaling pathway
    6464 (SHC1)
  Endocrine system
   04910 Insulin signaling pathway
    6464 (SHC1)
   04915 Estrogen signaling pathway
    6464 (SHC1)
   04917 Prolactin signaling pathway
    6464 (SHC1)
  Nervous system
   04722 Neurotrophin signaling pathway
    6464 (SHC1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    6464 (SHC1)
   05214 Glioma
    6464 (SHC1)
   05220 Chronic myeloid leukemia
    6464 (SHC1)
  Substance dependence
   05034 Alcoholism
    6464 (SHC1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    6464 (SHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 583 aa AA seqDB search
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccactccggaatgagtctctgtcatcg
ctggaggaaggggcttctgggtccacccccccggaggagctgccttccccatcagcttca
tccctggggcccatcctgcctcctctgcctggggacgatagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaggctggccaacccggctggggggcgcccagggtct
aagggggagccaggaagggcagctgatgatggggaggggatcgtaggggcagccatgcca
gactcaggccccctacccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagcttgggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggttgtgtggaggtcctccagtcaatgcgtgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccgctcagctctatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatctatc
tcatttgcatccggcggggatccggacacagccgagtatgtcgcctatgttgccaaagac
cctgtgaatcagagagcctgccacattctggagtgtcccgaagggcttgcccaggatgtc
atcagcaccattggccaggccttcgagttgcgcttcaaacaatacctcaggaacccaccc
aaactggtcacccctcatgacaggatggctggctttgatggctcagcatgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccccttg
gggggggtggtagacatgaggcttcgggaaggagccgctccaggggctgctcgacccact
gcacccaatgcccagacccccagccacttgggagctacattgcctgtaggacagcctgtt
gggggagatccagaagtccgcaaacagatgccacctccaccaccctgtccaggcagagag
ctttttgatgatccctcctatgtcaacgtccagaacctagacaaggcccggcaagcagtg
ggtggtgctgggccccccaatcctgctatcaatggcagtgcaccccgggacctgtttgac
atgaagcccttcgaagatgctcttcgcgtgcctccacctccccagtcggtgtccatggct
gagcagctccgaggggagccctggttccatgggaagctgagccggcgggaggctgaggca
ctgctgcagctcaatggggacttcctggtacgggagagcacgaccacacctggccagtat
gtgctcactggcttgcagagtgggcagcctaagcatttgctactggtggaccctgagggt
gtggttcggactaaggatcaccgctttgaaagtgtcagtcaccttatcagctaccacatg
gacaatcacttgcccatcatctctgcgggcagcgaactgtgtctacagcaacctgtggag
cggaaactgtga

DBGET integrated database retrieval system