KEGG   Homo sapiens (human): 6464Help
Entry
6464              CDS       T01001                                 

Gene name
SHC1, SHC, SHCA
Definition
SHC (Src homology 2 domain containing) transforming protein 1
Orthology
K06279  
SHC- transforming protein 1
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Insulin signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Bacterial invasion of epithelial cells
MicroRNAs in cancer
Glioma
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Glioma [PATH:hsa05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 584 aa AA seqDB search
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPAGR
ELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccactccggaatgagtctctgtcatcg
ctggaggaaggggcttctgggtccacccccccggaggagctgccttccccatcagcttca
tccctggggcccatcctgcctcctctgcctggggacgatagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaggctggccaacccggctggggggcgcccagggtct
aagggggagccaggaagggcagctgatgatggggaggggatcgtaggggcagccatgcca
gactcaggccccctacccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagcttgggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggttgtgtggaggtcctccagtcaatgcgtgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccgctcagctctatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatctatc
tcatttgcatccggcggggatccggacacagccgagtatgtcgcctatgttgccaaagac
cctgtgaatcagagagcctgccacattctggagtgtcccgaagggcttgcccaggatgtc
atcagcaccattggccaggccttcgagttgcgcttcaaacaatacctcaggaacccaccc
aaactggtcacccctcatgacaggatggctggctttgatggctcagcatgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccccttg
gggggggtggtagacatgaggcttcgggaaggagccgctccaggggctgctcgacccact
gcacccaatgcccagacccccagccacttgggagctacattgcctgtaggacagcctgtt
gggggagatccagaagtccgcaaacagatgccacctccaccaccctgtccagcaggcaga
gagctttttgatgatccctcctatgtcaacgtccagaacctagacaaggcccggcaagca
gtgggtggtgctgggccccccaatcctgctatcaatggcagtgcaccccgggacctgttt
gacatgaagcccttcgaagatgctcttcgcgtgcctccacctccccagtcggtgtccatg
gctgagcagctccgaggggagccctggttccatgggaagctgagccggcgggaggctgag
gcactgctgcagctcaatggggacttcctggtacgggagagcacgaccacacctggccag
tatgtgctcactggcttgcagagtgggcagcctaagcatttgctactggtggaccctgag
ggtgtggttcggactaaggatcaccgctttgaaagtgtcagtcaccttatcagctaccac
atggacaatcacttgcccatcatctctgcgggcagcgaactgtgtctacagcaacctgtg
gagcggaaactgtga

DBGET integrated database retrieval system