KEGG   Homo sapiens (human): 6464Help
Entry
6464              CDS       T01001                                 

Gene name
SHC1, SHC, SHCA
Definition
(RefSeq) SHC adaptor protein 1
  KO
K06279  SHC-transforming protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04510  Focal adhesion
hsa04650  Natural killer cell mediated cytotoxicity
hsa04722  Neurotrophin signaling pathway
hsa04910  Insulin signaling pathway
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05034  Alcoholism
hsa05100  Bacterial invasion of epithelial cells
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05220  Chronic myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    6464 (SHC1)
   04012 ErbB signaling pathway
    6464 (SHC1)
   04072 Phospholipase D signaling pathway
    6464 (SHC1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    6464 (SHC1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    6464 (SHC1)
   04062 Chemokine signaling pathway
    6464 (SHC1)
  Endocrine system
   04910 Insulin signaling pathway
    6464 (SHC1)
   04915 Estrogen signaling pathway
    6464 (SHC1)
   04917 Prolactin signaling pathway
    6464 (SHC1)
   04926 Relaxin signaling pathway
    6464 (SHC1)
  Nervous system
   04722 Neurotrophin signaling pathway
    6464 (SHC1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    6464 (SHC1)
   05225 Hepatocellular carcinoma
    6464 (SHC1)
   05226 Gastric cancer
    6464 (SHC1)
   05214 Glioma
    6464 (SHC1)
   05220 Chronic myeloid leukemia
    6464 (SHC1)
   05224 Breast cancer
    6464 (SHC1)
  Substance dependence
   05034 Alcoholism
    6464 (SHC1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    6464 (SHC1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    6464 (SHC1)
   01522 Endocrine resistance
    6464 (SHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 6464
NCBI-ProteinID: NP_892113
OMIM: 600560
HGNC: 10840
Ensembl: ENSG00000160691
Vega: OTTHUMG00000037295
Pharos: P29353(Tchem)
UniProt: P29353
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 583 aa AA seqDB search
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccactccggaatgagtctctgtcatcg
ctggaggaaggggcttctgggtccacccccccggaggagctgccttccccatcagcttca
tccctggggcccatcctgcctcctctgcctggggacgatagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaggctggccaacccggctggggggcgcccagggtct
aagggggagccaggaagggcagctgatgatggggaggggatcgtaggggcagccatgcca
gactcaggccccctacccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagcttgggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggttgtgtggaggtcctccagtcaatgcgtgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccgctcagctctatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatctatc
tcatttgcatccggcggggatccggacacagccgagtatgtcgcctatgttgccaaagac
cctgtgaatcagagagcctgccacattctggagtgtcccgaagggcttgcccaggatgtc
atcagcaccattggccaggccttcgagttgcgcttcaaacaatacctcaggaacccaccc
aaactggtcacccctcatgacaggatggctggctttgatggctcagcatgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccccttg
gggggggtggtagacatgaggcttcgggaaggagccgctccaggggctgctcgacccact
gcacccaatgcccagacccccagccacttgggagctacattgcctgtaggacagcctgtt
gggggagatccagaagtccgcaaacagatgccacctccaccaccctgtccaggcagagag
ctttttgatgatccctcctatgtcaacgtccagaacctagacaaggcccggcaagcagtg
ggtggtgctgggccccccaatcctgctatcaatggcagtgcaccccgggacctgtttgac
atgaagcccttcgaagatgctcttcgcgtgcctccacctccccagtcggtgtccatggct
gagcagctccgaggggagccctggttccatgggaagctgagccggcgggaggctgaggca
ctgctgcagctcaatggggacttcctggtacgggagagcacgaccacacctggccagtat
gtgctcactggcttgcagagtgggcagcctaagcatttgctactggtggaccctgagggt
gtggttcggactaaggatcaccgctttgaaagtgtcagtcaccttatcagctaccacatg
gacaatcacttgcccatcatctctgcgggcagcgaactgtgtctacagcaacctgtggag
cggaaactgtga

DBGET integrated database retrieval system