KEGG   Homo sapiens (human): 64714Help
Entry
64714             CDS       T01001                                 

Gene name
PDIA2, PDA2, PDI, PDIP, PDIR
Definition
(RefSeq) protein disulfide isomerase family A member 2
  KO
K09581  protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     64714 (PDIA2)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   64714 (PDIA2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    64714 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 Thioredoxin_7 AhpC-TSA Thioredoxin_8 TraF Redoxin
Motif
Other DBs
NCBI-GeneID: 64714
NCBI-ProteinID: NP_006840
OMIM: 608012
HGNC: 14180
Ensembl: ENSG00000185615
Vega: OTTHUMG00000064891
Pharos: Q13087(Tbio)
UniProt: Q13087
Position
16p13.3
AA seq 525 aa AA seqDB search
MSRQLLPVLLLLLLRASCPWGQEQGARSPSEEPPEEEIPKEDGILVLSRHTLGLALREHP
ALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTL
KFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQ
DLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFPVDEEL
GLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEA
APRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASI
TAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTH
CKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKS
TRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccagcttctgcctgtactgctgctgctgctgctcagggcttcgtgcccatgg
ggtcaggaacagggagcgaggagcccctcggaggagcctccagaggaggaaatccccaag
gaggatgggatcttggtgctgagccgccacaccctgggcctggccctgcgggagcaccct
gccctgctggtggaattctatgccccgtggtgtgggcactgccaggccctggcccccgag
tacagcaaggcagctgccgtgctcgcggccgagtcaatggtggtcacgctggccaaggtg
gatgggcccgcgcagcgcgagctggctgaggagtttggtgtgacggagtaccctacgctc
aagttcttccgcaatgggaaccgcacgcacccggaggagtacacaggaccacgggacgct
gagggcattgccgagtggctgcgacggcgggtggggcccagtgccatgcggctggaggac
gaggcggccgcccaggcgctgatcggtggccgggacctagtggtcattggcttcttccag
gacctgcaggacgaggacgtggccaccttcttggccttggcccaggacgccctggacatg
acctttggcctcacagaccggccgcggctctttcagcagtttggcctcaccaaggacact
gtggttctcttcaagaagtttgatgaggggcgggcagacttccccgtggacgaggagctt
ggcctggacctgggggatctgtcgcgcttcctggtcacacacagcatgcgcctggtcacg
gagttcaacagccagacgtctgccaagatcttcgcggccaggatcctcaaccacctgctg
ctgtttgtcaaccagacgctggctgcgcaccgggagctcctagcgggctttggggaggca
gctccccgcttccgggggcaggtgctgttcgtggtggtggacgtggcggccgacaatgag
cacgtgctgcagtactttggactcaaggctgaggcagcccccactctgcgcttggtcaac
cttgaaaccactaagaagtatgcgcctgtggatgggggccctgtcaccgcagcgtccatc
actgctttctgccatgcagtcctcaacggccaagtcaagccctatctcctgagccaggag
ataccccctgattgggatcagcggccagttaagaccctcgtgggcaagaattttgagcag
gtggcttttgacgaaaccaagaatgtgtttgtcaagttctatgccccgtggtgcacccac
tgcaaggagatggcccctgcctgggaggcattggctgagaagtaccaagaccacgaggac
atcatcattgctgagctggatgccacggccaacgagctggatgccttcgctgtgcacggc
ttccctactctcaagtacttcccagcagggccaggtcggaaggtgattgaatacaaaagc
accagggacctggagactttctccaagttcctggacaacgggggcgtgctgcccacggag
gagcccccggaggagccagcagccccgttcccggagccaccggccaactccactatgggg
tccaaggaggaactgtag

DBGET integrated database retrieval system