KEGG   Homo sapiens (human): 64714Help
Entry
64714             CDS       T01001                                 

Gene name
PDIA2, PDA2, PDI, PDIP, PDIR
Definition
protein disulfide isomerase family A, member 2 (EC:5.3.4.1)
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     64714 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 525 aa AA seqDB search
MSRQLLPVLLLLLLRASCPWGQEQGARSPSEEPPEEEIPKEDGILVLSRHTLGLALREHP
ALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTL
KFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQ
DLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFPVDEEL
GLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEA
APRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASI
TAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTH
CKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKS
TRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccagcttctgcctgtactgctgctgctgctgctcagggcttcgtgcccatgg
ggtcaggaacagggagcgaggagcccctcggaggagcctccagaggaggaaatccccaag
gaggatgggatcttggtgctgagccgccacaccctgggcctggccctgcgggagcaccct
gccctgctggtggaattctatgccccgtggtgtgggcactgccaggccctggcccccgag
tacagcaaggcagctgccgtgctcgcggccgagtcaatggtggtcacgctggccaaggtg
gatgggcccgcgcagcgcgagctggctgaggagtttggtgtgacggagtaccctacgctc
aagttcttccgcaatgggaaccgcacgcacccggaggagtacacaggaccacgggacgct
gagggcattgccgagtggctgcgacggcgggtggggcccagtgccatgcggctggaggac
gaggcggccgcccaggcgctgatcggtggccgggacctagtggtcattggcttcttccag
gacctgcaggacgaggacgtggccaccttcttggccttggcccaggacgccctggacatg
acctttggcctcacagaccggccgcggctctttcagcagtttggcctcaccaaggacact
gtggttctcttcaagaagtttgatgaggggcgggcagacttccccgtggacgaggagctt
ggcctggacctgggggatctgtcgcgcttcctggtcacacacagcatgcgcctggtcacg
gagttcaacagccagacgtctgccaagatcttcgcggccaggatcctcaaccacctgctg
ctgtttgtcaaccagacgctggctgcgcaccgggagctcctagcgggctttggggaggca
gctccccgcttccgggggcaggtgctgttcgtggtggtggacgtggcggccgacaatgag
cacgtgctgcagtactttggactcaaggctgaggcagcccccactctgcgcttggtcaac
cttgaaaccactaagaagtatgcgcctgtggatgggggccctgtcaccgcagcgtccatc
actgctttctgccatgcagtcctcaacggccaagtcaagccctatctcctgagccaggag
ataccccctgattgggatcagcggccagttaagaccctcgtgggcaagaattttgagcag
gtggcttttgacgaaaccaagaatgtgtttgtcaagttctatgccccgtggtgcacccac
tgcaaggagatggcccctgcctgggaggcattggctgagaagtaccaagaccacgaggac
atcatcattgctgagctggatgccacggccaacgagctggatgccttcgctgtgcacggc
ttccctactctcaagtacttcccagcagggccaggtcggaaggtgattgaatacaaaagc
accagggacctggagactttctccaagttcctggacaacgggggcgtgctgcccacggag
gagcccccggaggagccagcagccccgttcccggagccaccggccaactccactatgggg
tccaaggaggaactgtag

DBGET integrated database retrieval system