KEGG   Homo sapiens (human): 650Help
Entry
650               CDS       T01001                                 

Gene name
BMP2, BDA2, BMP2A, SSFSC
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Module
hsa_M00679  BMP signaling
Network
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
Disease
H00482  Brachydactyly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    650 (BMP2)
   04390 Hippo signaling pathway
    650 (BMP2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    650 (BMP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    650 (BMP2)
   05217 Basal cell carcinoma
    650 (BMP2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   650 (BMP2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens (General comment) Effective diffusion, tissue differentiation, development
   650 (BMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 650
NCBI-ProteinID: NP_001191
OMIM: 112261
HGNC: 1069
Ensembl: ENSG00000125845
Vega: OTTHUMG00000031833
Pharos: P12643(Tbio)
UniProt: P12643 C8C060
Structure
PDB: 

Jmol
Position
20p12.3
AA seq 396 aa AA seqDB search
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggctggcctcgttccggagctgggccgcaggaagttcgcggcggcgtcgtcgggccgc
ccctcatcccagccctctgacgaggtcctgagcgagttcgagttgcggctgctcagcatg
ttcggcctgaaacagagacccacccccagcagggacgccgtggtgcccccctacatgcta
gacctgtatcgcaggcactcaggtcagccgggctcacccgccccagaccaccggttggag
agggcagccagccgagccaacactgtgcgcagcttccaccatgaagaatctttggaagaa
ctaccagaaacgagtgggaaaacaacccggagattcttctttaatttaagttctatcccc
acggaggagtttatcacctcagcagagcttcaggttttccgagaacagatgcaagatgct
ttaggaaacaatagcagtttccatcaccgaattaatatttatgaaatcataaaacctgca
acagccaactcgaaattccccgtgaccagacttttggacaccaggttggtgaatcagaat
gcaagcaggtgggaaagttttgatgtcacccccgctgtgatgcggtggactgcacaggga
cacgccaaccatggattcgtggtggaagtggcccacttggaggagaaacaaggtgtctcc
aagagacatgttaggataagcaggtctttgcaccaagatgaacacagctggtcacagata
aggccattgctagtaacttttggccatgatggaaaagggcatcctctccacaaaagagaa
aaacgtcaagccaaacacaaacagcggaaacgccttaagtccagctgtaagagacaccct
ttgtacgtggacttcagtgacgtggggtggaatgactggattgtggctcccccggggtat
cacgccttttactgccacggagaatgcccttttcctctggctgatcatctgaactccact
aatcatgccattgttcagacgttggtcaactctgttaactctaagattcctaaggcatgc
tgtgtcccgacagaactcagtgctatctcgatgctgtaccttgacgagaatgaaaaggtt
gtattaaagaactatcaggacatggttgtggagggttgtgggtgtcgctag

DBGET integrated database retrieval system