KEGG   Homo sapiens (human): 6500Help
Entry
6500              CDS       T01001                                 

Gene name
SKP1, EMC19, OCP-II, OCP2, SKP1A, TCEB1L, p19A
Definition
(RefSeq) S-phase kinase associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04710  Circadian rhythm
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
Module
hsa_M00380  SCF-BTRC complex
hsa_M00381  SCF-SKP2 complex
hsa_M00382  SCF-FBS complex
hsa_M00387  SCF-FBW7 complex
Network
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6500 (SKP1)
   04120 Ubiquitin mediated proteolysis
    6500 (SKP1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6500 (SKP1)
   04350 TGF-beta signaling pathway
    6500 (SKP1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    6500 (SKP1)
   04114 Oocyte meiosis
    6500 (SKP1)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    6500 (SKP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6500 (SKP1)
  Infectious diseases
   05168 Herpes simplex infection
    6500 (SKP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     6500 (SKP1)
   Cul7 complex
     6500 (SKP1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     6500 (SKP1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     6500 (SKP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1 Skp1_POZ
Motif
Other DBs
NCBI-GeneID: 6500
NCBI-ProteinID: NP_733779
OMIM: 601434
HGNC: 10899
Ensembl: ENSG00000113558
Vega: OTTHUMG00000129117
Pharos: P63208(Tbio)
UniProt: P63208
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 163 aa AA seqDB search
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaattaagttgcagagttctgatggagagatatttgaagttgatgtggaaatt
gccaaacaatctgtgactattaagaccatgttggaagatttgggaatggatgatgaagga
gatgatgacccagttcctctaccaaatgtgaatgcagcaatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctcctcctgaagatgatgagaacaaagaaaag
cgaacagatgatatccctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaactcattctggctgcaaactacttagacatcaaaggtttgcttgatgttacatgc
aagactgttgccaatatgatcaaggggaaaactcctgaggagattcgcaagaccttcaat
atcaaaaatgactttactgaagaggaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system