KEGG   Homo sapiens (human): 6500Help
Entry
6500              CDS       T01001                                 

Gene name
SKP1, EMC19, OCP-II, OCP2, SKP1A, TCEB1L, p19A
Definition
S-phase kinase-associated protein 1 (EC:3.1.1.3)
Orthology
K03094  
S-phase kinase-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Wnt signaling pathway
TGF-beta signaling pathway
Circadian rhythm
Herpes simplex infection
Module
SCF-BTRC complex
SCF-SKP2 complex
SCF-FBS complex
SCF-FBW7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6500 (SKP1)
   04120 Ubiquitin mediated proteolysis
    6500 (SKP1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6500 (SKP1)
   04350 TGF-beta signaling pathway
    6500 (SKP1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    6500 (SKP1)
   04114 Oocyte meiosis
    6500 (SKP1)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    6500 (SKP1)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6500 (SKP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    adaptor protein
     6500 (SKP1)
   Cul7 complex
     6500 (SKP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31
AA seq 160 aa AA seqDB search
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaattaagttgcagagttctgatggagagatatttgaagttgatgtggaaatt
gccaaacaatctgtgactattaagaccatgttggaagatttgggaatggatgatgaagga
gatgatgacccagttcctctaccaaatgtgaatgcagcaatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctcctcctgaagatgatgagaacaaagaaaag
cgaacagatgatatccctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaactcattctggctgcaaactacttagacatcaaaggtttgcttgatgttacatgc
aagactgttgccaatatgatcaaggggaaaactcctgaggagattcgcaagaccttcaat
atcaaaaatgactttactgaagaggaggaagcccaggtaggtagcacacagttttgtctt
tga

DBGET integrated database retrieval system