KEGG   Homo sapiens (human): 65018Help
Entry
65018             CDS       T01001                                 

Gene name
PINK1, BRPK, PARK6
Definition
PTEN induced putative kinase 1 (EC:2.7.11.1)
Orthology
K05688  
PTEN induced putative kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    65018 (PINK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65018 (PINK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NKF2 family
   65018 (PINK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    65018 (PINK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36
AA seq 581 aa AA seqDB search
MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVG
LGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRR
AVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQ
NLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQE
LVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP
SRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAH
RDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVST
ARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPP
DVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLL
ANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAAL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcgacaggcgctgggccgcggcctgcagctgggtcgagcgctgctgctgcgc
ttcacgggcaagcccggccgggcctacggcttggggcggccgggcccggcggcgggctgt
gtccgcggggagcgtccaggctgggccgcaggaccgggcgcggagcctcgcagggtcggg
ctcgggctccctaaccgtctccgcttcttccgccagtcggtggccgggctggcggcgcgg
ttgcagcggcagttcgtggtgcgggcctggggctgcgcgggcccttgcggccgggcagtc
tttctggccttcgggctagggctgggcctcatcgaggaaaaacaggcggagagccggcgg
gcggtctcggcctgtcaggagatccaggcaatttttacccagaaaagcaagccggggcct
gacccgttggacacgagacgcttgcagggctttcggctggaggagtatctgatagggcag
tccattggtaagggctgcagtgctgctgtgtatgaagccaccatgcctacattgccccag
aacctggaggtgacaaagagcaccgggttgcttccagggagaggcccaggtaccagtgca
ccaggagaagggcaggagcgagctccgggggcccctgccttccccttggccatcaagatg
atgtggaacatctcggcaggttcctccagcgaagccatcttgaacacaatgagccaggag
ctggtcccagcgagccgagtggccttggctggggagtatggagcagtcacttacagaaaa
tccaagagaggtcccaagcaactagcccctcaccccaacatcatccgggttctccgcgcc
ttcacctcttccgtgccgctgctgccaggggccctggtcgactaccctgatgtgctgccc
tcacgcctccaccctgaaggcctgggccatggccggacgctgttcctcgttatgaagaac
tatccctgtaccctgcgccagtacctttgtgtgaacacacccagcccccgcctcgccgcc
atgatgctgctgcagctgctggaaggcgtggaccatctggttcaacagggcatcgcgcac
agagacctgaaatccgacaacatccttgtggagctggacccagacggctgcccctggctg
gtgatcgcagattttggctgctgcctggctgatgagagcatcggcctgcagttgcccttc
agcagctggtacgtggatcggggcggaaacggctgtctgatggccccagaggtgtccacg
gcccgtcctggccccagggcagtgattgactacagcaaggctgatgcctgggcagtggga
gccatcgcctatgaaatcttcgggcttgtcaatcccttctacggccagggcaaggcccac
cttgaaagccgcagctaccaagaggctcagctacctgcactgcccgagtcagtgcctcca
gacgtgagacagttggtgagggcactgctccagcgagaggccagcaagagaccatctgcc
cgagtagccgcaaatgtgcttcatctaagcctctggggtgaacatattctagccctgaag
aatctgaagttagacaagatggttggctggctcctccaacaatcggccgccactttgttg
gccaacaggctcacagagaagtgttgtgtggaaacaaaaatgaagatgctctttctggct
aacctggagtgtgaaacgctctgccaggcagccctcctcctctgctcatggagggcagcc
ctgtga

DBGET integrated database retrieval system