KEGG   Homo sapiens (human): 6502Help
Entry
6502              CDS       T01001                                 

Gene name
SKP2, FBL1, FBXL1, FLB1, p45
Definition
S-phase kinase-associated protein 2, E3 ubiquitin protein ligase
Orthology
K03875  
F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Ubiquitin mediated proteolysis
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Module
SCF-SKP2 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13
AA seq 210 aa AA seqDB search
MDQPLAEHFSTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHV
QVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQL
NYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFT
TIARPTIGNKKNQEIWGIKCRLTLQKPSCL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaccattggctgaacatttcagtactctcgcaaaaaactcaaatttagtgcga
cttaacctttctgggtgttctggattctctgaatttgccctgcagactttgctaagcagc
tgttccagactggatgagctgaacctctcctggtgttttgatttcactgaaaagcatgta
caggtggctgttgcgcatgtgtcagagaccatcacccagctgaatcttagcggctacaga
aagaatctccagaaatcagatctctctactttagttagaagatgccccaatcttgtccat
ctagacttaagtgatagtgtcatgctaaagaatgactgctttcaggaatttttccagctc
aactacctccaacacctatcactcagtcggtgctatgatataatacctgaaactttactt
gaacttggagaaattcccacactaaaaacactacaagtttttggaatcgtgccagatggt
acccttcaactgttaaaggaagcccttcctcatctacagattaattgctcccatttcacc
accattgccaggccaactattggcaacaaaaagaaccaggagatatggggcatcaaatgc
cgactgacactgcaaaagcccagttgtctatga

DBGET integrated database retrieval system