KEGG   Homo sapiens (human): 6502Help
Entry
6502              CDS       T01001                                 

Gene name
SKP2, FBL1, FBXL1, FLB1, p45
Definition
S-phase kinase-associated protein 2, E3 ubiquitin protein ligase
Orthology
K03875  
F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Ubiquitin mediated proteolysis
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Module
SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6502 (SKP2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    6502 (SKP2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    6502 (SKP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6502 (SKP2)
   05203 Viral carcinogenesis
    6502 (SKP2)
   05222 Small cell lung cancer
    6502 (SKP2)
  Infectious diseases
   05168 Herpes simplex infection
    6502 (SKP2)
   05169 Epstein-Barr virus infection
    6502 (SKP2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     6502 (SKP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13
AA seq 210 aa AA seqDB search
MDQPLAEHFSTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHV
QVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQL
NYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFT
TIARPTIGNKKNQEIWGIKCRLTLQKPSCL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaccattggctgaacatttcagtactctcgcaaaaaactcaaatttagtgcga
cttaacctttctgggtgttctggattctctgaatttgccctgcagactttgctaagcagc
tgttccagactggatgagctgaacctctcctggtgttttgatttcactgaaaagcatgta
caggtggctgttgcgcatgtgtcagagaccatcacccagctgaatcttagcggctacaga
aagaatctccagaaatcagatctctctactttagttagaagatgccccaatcttgtccat
ctagacttaagtgatagtgtcatgctaaagaatgactgctttcaggaatttttccagctc
aactacctccaacacctatcactcagtcggtgctatgatataatacctgaaactttactt
gaacttggagaaattcccacactaaaaacactacaagtttttggaatcgtgccagatggt
acccttcaactgttaaaggaagcccttcctcatctacagattaattgctcccatttcacc
accattgccaggccaactattggcaacaaaaagaaccaggagatatggggcatcaaatgc
cgactgacactgcaaaagcccagttgtctatga

DBGET integrated database retrieval system