KEGG   Homo sapiens (human): 6506Help
Entry
6506              CDS       T01001                                 

Gene name
SLC1A2, EAAT2, GLT-1
Definition
solute carrier family 1 (glial high affinity glutamate transporter), member 2
Orthology
K05613  
solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
Amyotrophic lateral sclerosis (ALS)
Class
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p13-p12
AA seq 565 aa AA seqDB search
MPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVCGGLLRLASP
IHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTI
IAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQ
TVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFF
IAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVV
ARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLP
VTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVS
LTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFG
AGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDE
CKVTLAANGKSADCSVEEEPWKREK
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcaggtggaagtgcgaatgcacgacagtcatcttggctcagaggaacccaag
caccggcacctgggcctgcgcctgtgtgacaagctggggaagaatctgctgctcaccctg
acggtgtttggtgtcatcctgggagcagtgtgtggagggcttcttcgcttggcatctccc
atccaccctgatgtggttatgttaatagccttcccaggggatatactcatgaggatgcta
aaaatgctcattctccctctaatcatctccagcttaatcacagggttgtcaggcctggat
gctaaggctagtggccgcttgggcacgagagccatggtgtattacatgtccacgaccatc
attgctgcagtactgggggtcattctggtcttggctatccatccaggcaatcccaagctc
aagaagcagctggggcctgggaagaagaatgatgaagtgtccagcctggatgccttcctg
gaccttattcgaaatctcttccctgaaaaccttgtccaagcctgctttcaacagattcaa
acagtgacgaagaaagtcctggttgcaccaccgccggacgaggaggccaacgcaaccagc
gctgttgtctctctgttgaacgagactgtgactgaggtgccggaggagactaagatggtt
atcaagaagggcctggagttcaaggatgggatgaacgtcttaggtctgatagggtttttc
attgcttttggcatcgctatggggaagatgggagatcaggccaagctgatggtggatttc
ttcaacattttgaatgagattgtaatgaagttagtgatcatgatcatgtggtactctccc
ctgggtatcgcctgcctgatctgtggaaagatcattgcaatcaaggacttagaagtggtt
gctaggcaactggggatgtacatggtaacagtgatcataggcctcatcatccacgggggc
atctttctccccttgatttactttgtagtgaccaggaaaaaccccttctccttttttgct
ggcattttccaagcttggatcactgccctgggcaccgcttccagtgctggaactttgcct
gtcacctttcgttgcctggaagaaaatctggggattgataagcgtgtgactagattcgtc
cttcctgttggagcaaccattaacatggatggtacagccctttatgaagcggtagccgcc
atctttatagcccaaatgaatggtgttgtcctggatggaggacagattgtgactgtaagc
ctcacagccaccctggcaagcgtcggcgcggccagtatccccagtgccgggctggtcacc
atgctcctcattctgacagccgtgggcctgccaacagaggacatcagcctgctggtggct
gtggactggctgctggacaggatgagaacttcagtcaatgttgtgggtgactcttttggg
gctgggatagtctatcacctctccaagtctgagctggataccattgactcccagcatcga
gtgcatgaagatattgaaatgaccaagactcaatccatttatgatgacatgaagaaccac
agggaaagcaactctaatcaatgtgtctatgctgcacacaactctgtcatagtagatgaa
tgcaaggtaactctggcagccaatggaaagtcagccgactgcagtgttgaggaagaacct
tggaaacgtgagaaataa

DBGET integrated database retrieval system