KEGG   Homo sapiens (human): 6506Help
Entry
6506              CDS       T01001                                 

Gene name
SLC1A2, EAAT2, GLT-1, HBGT
Definition
(RefSeq) solute carrier family 1 member 2
  KO
K05613  
solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    6506 (SLC1A2)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    6506 (SLC1A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   6506 (SLC1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p13
AA seq 574 aa AA seqDB search
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcatctacggaaggtgccaacaatatgcccaagcaggtggaagtgcgaatgcacgac
agtcatcttggctcagaggaacccaagcaccggcacctgggcctgcgcctgtgtgacaag
ctggggaagaatctgctgctcaccctgacggtgtttggtgtcatcctgggagcagtgtgt
ggagggcttcttcgcttggcatctcccatccaccctgatgtggttatgttaatagccttc
ccaggggatatactcatgaggatgctaaaaatgctcattctccctctaatcatctccagc
ttaatcacagggttgtcaggcctggatgctaaggctagtggccgcttgggcacgagagcc
atggtgtattacatgtccacgaccatcattgctgcagtactgggggtcattctggtcttg
gctatccatccaggcaatcccaagctcaagaagcagctggggcctgggaagaagaatgat
gaagtgtccagcctggatgccttcctggaccttattcgaaatctcttccctgaaaacctt
gtccaagcctgctttcaacagattcaaacagtgacgaagaaagtcctggttgcaccaccg
ccggacgaggaggccaacgcaaccagcgctgttgtctctctgttgaacgagactgtgact
gaggtgccggaggagactaagatggttatcaagaagggcctggagttcaaggatgggatg
aacgtcttaggtctgatagggtttttcattgcttttggcatcgctatggggaagatggga
gatcaggccaagctgatggtggatttcttcaacattttgaatgagattgtaatgaagtta
gtgatcatgatcatgtggtactctcccctgggtatcgcctgcctgatctgtggaaagatc
attgcaatcaaggacttagaagtggttgctaggcaactggggatgtacatggtaacagtg
atcataggcctcatcatccacgggggcatctttctccccttgatttactttgtagtgacc
aggaaaaaccccttctccttttttgctggcattttccaagcttggatcactgccctgggc
accgcttccagtgctggaactttgcctgtcacctttcgttgcctggaagaaaatctgggg
attgataagcgtgtgactagattcgtccttcctgttggagcaaccattaacatggatggt
acagccctttatgaagcggtagccgccatctttatagcccaaatgaatggtgttgtcctg
gatggaggacagattgtgactgtaagcctcacagccaccctggcaagcgtcggcgcggcc
agtatccccagtgccgggctggtcaccatgctcctcattctgacagccgtgggcctgcca
acagaggacatcagcctgctggtggctgtggactggctgctggacaggatgagaacttca
gtcaatgttgtgggtgactcttttggggctgggatagtctatcacctctccaagtctgag
ctggataccattgactcccagcatcgagtgcatgaagatattgaaatgaccaagactcaa
tccatttatgatgacatgaagaaccacagggaaagcaactctaatcaatgtgtctatgct
gcacacaactctgtcatagtagatgaatgcaaggtaactctggcagccaatggaaagtca
gccgactgcagtgttgaggaagaaccttggaaacgtgagaaataa

DBGET integrated database retrieval system