KEGG   Homo sapiens (human): 653361Help
Entry
653361            CDS       T01001                                 

Gene name
NCF1, NCF1A, NOXO2, SH3PXD1A, p47phox
Definition
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  
neutrophil cytosolic factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Phagosome
Osteoclast differentiation
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Leishmaniasis
Disease
H00098  
Chronic granulomatous disease
H01167  
Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    653361 (NCF1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    653361 (NCF1)
   04670 Leukocyte transendothelial migration
    653361 (NCF1)
   04062 Chemokine signaling pathway
    653361 (NCF1)
  Development
   04380 Osteoclast differentiation
    653361 (NCF1)
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    653361 (NCF1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    653361 (NCF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 390 aa AA seqDB search
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPI
EAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKV
RPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTG
DVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAV
EGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPP
RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSK
PQPAVPPRPSADLILNRCSESTKRKLASAV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggggacaccttcatccgtcacatcgccctgctgggctttgagaagcgcttcgtaccc
agccagcactatgtgtacatgttcctggtgaaatggcaggacctgtcggagaaggtggtc
taccggcgcttcaccgagatctacgagttccataaaaccttaaaagaaatgttccctatt
gaggcaggggcgatcaatccagagaacaggatcatcccccacctcccagctcccaagtgg
tttgacgggcagcgggccgccgagaaccgccagggcacacttaccgagtactgcagcacg
ctcatgagcctgcccaccaagatctcccgctgtccccacctcctcgacttcttcaaggtg
cgccctgatgacctcaagctccccacggacaaccagacaaaaaagccagagacatacttg
atgcccaaagatggcaagagtaccgcgacagacatcaccggccccatcatcctgcagacg
taccgcgccattgccaactacgagaagacctcgggctccgagatggctctgtccacgggg
gacgtggtggaggtcgtagagaagagcgagagcggttggtggttctgtcagatgaaagca
aagcgaggctggatcccagcgtccttcctcgagcccctggacagtcctgacgagacggaa
gaccctgagcccaactatgcaggtgagccatacgtcgccatcaaggcctacactgctgtg
gagggggacgaggtgtccctgctcgagggtgaagctgttgaggtcattcacaagctcctg
gacggctggtgggtcatcaggaaagacgacgtcacaggctacttcccgtccatgtacctg
caaaagtcagggcaagacgtgtcccaggcccaacgccagatcaagcggggggcgccgccc
cgcaggtcgtccatccgcaacgcgcacagcatccaccagcggtcgcggaagcgcctcagc
caggacgcctatcgccgcaacagcgtccgttttctgcagcagcgacgccgccaggcgcgg
ccgggaccgcagagccccgggagcccgctcgaggaggagcggcagacgcagcgctctaaa
ccgcagccggcggtgcccccgcggccgagcgccgacctcatcctgaaccgctgcagcgag
agcaccaagcggaagctggcgtctgccgtctga

DBGET integrated database retrieval system