KEGG   Homo sapiens (human): 653361Help
Entry
653361            CDS       T01001                                 

Gene name
NCF1, NCF1A, NOXO2, SH3PXD1A, p47phox
Definition
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa05140  Leishmaniasis
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00098  Chronic granulomatous disease
H01167  Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    653361 (NCF1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    653361 (NCF1)
   04670 Leukocyte transendothelial migration
    653361 (NCF1)
   04062 Chemokine signaling pathway
    653361 (NCF1)
  Development
   04380 Osteoclast differentiation
    653361 (NCF1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    653361 (NCF1)
  Infectious diseases
   05140 Leishmaniasis
    653361 (NCF1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    653361 (NCF1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    653361 (NCF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 NECFESHC p47_phox_C PX SH3_2 hSH3 SH3_6
Motif
Other DBs
NCBI-GeneID: 653361
NCBI-ProteinID: NP_000256
OMIM: 608512
HGNC: 7660
Ensembl: ENSG00000158517
Vega: OTTHUMG00000149965
Pharos: P14598(Tbio)
UniProt: P14598
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 390 aa AA seqDB search
MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPI
EAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKV
RPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTG
DVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAV
EGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPP
RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSK
PQPAVPPRPSADLILNRCSESTKRKLASAV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggggacaccttcatccgtcacatcgccctgctgggctttgagaagcgcttcgtaccc
agccagcactatgtgtacatgttcctggtgaaatggcaggacctgtcggagaaggtggtc
taccggcgcttcaccgagatctacgagttccataaaaccttaaaagaaatgttccctatt
gaggcaggggcgatcaatccagagaacaggatcatcccccacctcccagctcccaagtgg
tttgacgggcagcgggccgccgagaaccgccagggcacacttaccgagtactgcagcacg
ctcatgagcctgcccaccaagatctcccgctgtccccacctcctcgacttcttcaaggtg
cgccctgatgacctcaagctccccacggacaaccagacaaaaaagccagagacatacttg
atgcccaaagatggcaagagtaccgcgacagacatcaccggccccatcatcctgcagacg
taccgcgccattgccaactacgagaagacctcgggctccgagatggctctgtccacgggg
gacgtggtggaggtcgtagagaagagcgagagcggttggtggttctgtcagatgaaagca
aagcgaggctggatcccagcgtccttcctcgagcccctggacagtcctgacgagacggaa
gaccctgagcccaactatgcaggtgagccatacgtcgccatcaaggcctacactgctgtg
gagggggacgaggtgtccctgctcgagggtgaagctgttgaggtcattcacaagctcctg
gacggctggtgggtcatcaggaaagacgacgtcacaggctacttcccgtccatgtacctg
caaaagtcagggcaagacgtgtcccaggcccaacgccagatcaagcggggggcgccgccc
cgcaggtcgtccatccgcaacgcgcacagcatccaccagcggtcgcggaagcgcctcagc
caggacgcctatcgccgcaacagcgtccgttttctgcagcagcgacgccgccaggcgcgg
ccgggaccgcagagccccgggagcccgctcgaggaggagcggcagacgcagcgctctaaa
ccgcagccggcggtgcccccgcggccgagcgccgacctcatcctgaaccgctgcagcgag
agcaccaagcggaagctggcgtctgccgtctga

DBGET integrated database retrieval system