KEGG   Homo sapiens (human): 653604Help
Entry
653604            CDS       T01001                                 

Gene name
HIST2H3D
Definition
histone cluster 2, H3d
Orthology
K11253  
histone H3
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    653604 (HIST2H3D)
  Immune diseases
   05322 Systemic lupus erythematosus
    653604 (HIST2H3D)
  Substance dependence
   05034 Alcoholism
    653604 (HIST2H3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   653604 (HIST2H3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagactgcccgcaagtcgaccggcggcaaggccccgaggaagcag
ctggctaccaaagcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtggctctgcgggagatccggcgctaccagaagtctacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccatgccaagcgcgtgaccatc
atgcccaaggacatccagttggcccgccgcatccgcggggagcgggcctaa

DBGET integrated database retrieval system