KEGG   Homo sapiens (human): 6548Help
Entry
6548              CDS       T01001                                 

Gene name
SLC9A1, APNH, NHE-1, NHE1, PPP1R143
Definition
solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1
Orthology
K05742  
solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Regulation of actin cytoskeleton
Thyroid hormone signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Proteoglycans in cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    6548 (SLC9A1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    6548 (SLC9A1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    6548 (SLC9A1)
  Circulatory system
   04260 Cardiac muscle contraction
    6548 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    6548 (SLC9A1)
  Digestive system
   04970 Salivary secretion
    6548 (SLC9A1)
   04971 Gastric acid secretion
    6548 (SLC9A1)
   04972 Pancreatic secretion
    6548 (SLC9A1)
   04976 Bile secretion
    6548 (SLC9A1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6548 (SLC9A1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6548 (SLC9A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.1-p35
AA seq 815 aa AA seqDB search
MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDV
TTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFV
VALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPSERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITID
PASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTP
APSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggttctgcggtctggcatctgtggcctctctccacatcggatcttcccttccttactc
gtggtggttgctttggtggggctgctgcctgttctcaggagccatggcctccagctcagc
ccaactgccagcaccattcgaagctcagagccaccacgagaacgctcgattggggatgtc
accaccgctccaccggaggtcaccccagagagccgccctgttaatcattccgtcactgat
catggcatgaagccgcgcaaggcctttccagtcctgggcatcgactacacacacgtgcgc
acccccttcgagatctccctctggatccttctggcctgcctcatgaagataggtttccat
gtgatccccactatctcaagcatcgtcccggagagctgcctgctgatcgtggtggggctg
ctggtggggggcctgatcaagggtgtaggcgagacaccccccttcctgcagtccgacgtc
ttcttcctcttcctgctgccgcccatcatcctggatgcgggctacttcctgccactgcgg
cagttcacagaaaacctgggcaccatcctgatctttgccgtggtgggcacgctgtggaac
gccttcttcctgggcggcctcatgtacgccgtgtgcctggtgggcggtgagcagatcaac
aacatcggcctcctggacaacctgctcttcggcagcatcatctcggccgtggaccccgtg
gcggttctggctgtctttgaggaaattcacatcaatgagctgctgcacatccttgttttt
ggggagtccttgctcaatgacgccgtcactgtggtcctgtatcacctctttgaggagttt
gccaactacgaacacgtgggcatcgtggacatcttcctcggcttcctgagcttcttcgtg
gtggccctgggcggggtgcttgtgggcgtggtctacggggtcatcgcagccttcacctcc
cgatttacctcccacatccgggtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacttgtcagccgagctcttccacctgtcaggcatcatggcgctcatagcctcagga
gtggtgatgcgcccctatgtggaggccaacatctcccacaagtcccacaccaccatcaaa
tacttcctgaagatgtggagcagcgtcagcgagaccctcatcttcatcttcctcggcgtc
tccacggtggccggctcccaccactggaactggaccttcgtcatcagcaccctgctcttc
tgcctcatcgcccgcgtgctgggggtgctgggcctgacctggttcatcaacaagttccgt
atcgtgaagctgacccccaaggaccagttcatcatcgcctatgggggcctgcgaggggcc
atcgccttctctctgggctacctcctggacaagaagcacttccccatgtgtgacctgttc
ctcactgccatcatcactgtcatcttcttcaccgtctttgtgcagggcatgaccattcgg
cccctggtagacctgttggctgtgaagaaaaagcaagagacgaagcgctccatcaacgaa
gagatccacacacagttcctggaccaccttctgacaggcatcgaagacatctgtggccac
tacggtcaccaccactggaaggacaagctcaaccggtttaataagaaatatgtgaagaag
tgtctgatagctggcgagcgctccaaggagccccagctcattgccttctaccacaagatg
gagatgaagcaggccatcgagctggtggagagcgggggcatgggcaagatcccctctgcc
gtctccaccgtctccatgcagaacatccaccccaagtccctgccttccgagcgcatcctg
ccagcactgtccaaggacaaggaggaggagatccgcaaaatcctgaggaacaacttgcag
aagaccaggcagcggctgcggtcctacaacagacacacgctggtggcagacccctacgag
gaagcctggaaccagatgctgctccggaggcagaaggcccggcagctggagcagaagatc
aacaactacctgacggtgccagcccacaagctggactcacccaccatgtctcgggcccgc
atcggctcagacccactggcctatgagccgaaggaggacctgcctgtcatcaccatcgac
ccggcttccccgcagtcacccgagtctgtggacctggtgaatgaagagctgaagggcaaa
gtcttagggttgagccgggatcctgcaaaggtggctgaggaggacgaggacgacgatggg
ggcatcatgatgcggagcaaggagacttcgtccccaggaaccgacgatgtcttcaccccc
gcgcccagtgacagccccagctcccagaggatacagcgctgcctcagtgacccaggccca
caccctgagcctggggagggagaaccgttcttccccaaggggcagtaa

DBGET integrated database retrieval system