KEGG   Homo sapiens (human): 6556Help
Entry
6556              CDS       T01001                                 

Gene name
SLC11A1, LSH, NRAMP, NRAMP1
Definition
(RefSeq) solute carrier family 11 member 1
  KO
K12347  
natural resistance-associated macrophage protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00342  
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    6556 (SLC11A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC11: Proton-coupled metal ion transporter
   6556 (SLC11A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49279(Tbio)
UniProt: 
Position
2q35
AA seq 550 aa AA seqDB search
MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLSEKIPIPDTKPGTFSLRKLWA
FTGPGFLMSIAFLDPGNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKD
LGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRIPLWGGVLITIVD
TFFFLFLDNYGLRKLEAFFGLLITIMALTFGYEYVVARPEQGALLRGLFLPSCPGCGHPE
LLQAVGIVGAIIMPHNIYLHSALVKSREIDRARRADIREANMYFLIEATIALSVSFIINL
FVMAVFGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGVILGCLFGPAA
LYIWAIGLLAAGQSSTMTGTYAGQFVMEGFLRLRWSRFARVLLTRSCAILPTVLVAVFRD
LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPTLMQEFANGLLNKVVTSSIMVLVCAIN
LYFVVSYLPSLPHPAYFGLAALLAAAYLGLSTYLVWTCCLAHGATFLAHSSHHHFLYGLL
EEDQKGETSG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtgacaagggtccccaaaggctaagcgggtccagctatggttccatctccagc
ccgaccagcccgaccagcccagggccacagcaagcacctcccagagagacctacctgagt
gagaagatccccatcccagacacaaaaccgggcaccttcagcctgcggaagctatgggcc
ttcacggggcctggcttcctcatgagcattgctttcctggacccaggaaacatcgagtca
gatcttcaggctggcgccgtggcgggattcaaacttctctgggtgctgctctgggccacc
gtgttgggcttgctctgccagcgactggctgcacgtctgggcgtggtgacaggcaaggac
ttgggcgaggtctgccatctctactaccctaaggtgccccgcaccgtcctctggctgacc
atcgagctagccattgtgggctccgacatgcaggaagtcatcggcacggccattgcattc
aatctgctctcagctggacgaatcccactctggggtggcgtcctcatcaccatcgtggac
accttcttcttcctcttcctcgataactacgggctgcggaagctggaagctttttttgga
ctccttataaccattatggccttgacctttggctatgagtatgtggtggcgcgtcctgag
cagggagcgcttcttcggggcctgttcctgccctcgtgcccgggctgcggccaccccgag
ctgctgcaggcggtgggcattgttggcgccatcatcatgccccacaacatctacctgcac
tcggccctggtcaagtctcgagagatagaccgggcccgccgagcagacatcagagaagcc
aacatgtacttcctgattgaggccaccatcgccctgtccgtctcctttatcatcaacctc
tttgtcatggctgtctttgggcaggccttctaccagaaaaccaaccaggctgcgttcaac
atctgtgccaacagcagcctccacgactacgccaagatcttccccatgaacaacgccacc
gtggccgtggacatttaccaggggggcgtgatcctgggctgcctgttcggccccgcggcc
ctctacatctgggccataggtctcctggcggctgggcagagctccaccatgacgggcacc
tacgcgggacagttcgtgatggagggcttcctgaggctgcggtggtcacgcttcgcccgt
gtcctcctcacccgctcctgcgccatcctgcccaccgtgctcgtggctgtcttccgggac
ctgagggacttgtcgggcctcaatgatctgctcaacgtgctgcagagcctgctgctcccg
ttcgccgtgctgcccatcctcacgttcaccagcatgcccaccctcatgcaggagtttgcc
aatggcctgctgaacaaggtcgtcacctcttccatcatggtgctagtctgcgccatcaac
ctctacttcgtggtcagctatctgcccagcctgccccaccctgcctacttcggccttgca
gccttgctggccgcagcctacctgggcctcagcacctacctggtctggacctgttgcctt
gcccacggagccacctttctggcccacagctcccaccaccacttcctgtatgggctcctt
gaagaggaccagaaaggggagacctctggctag

DBGET integrated database retrieval system