KEGG   Homo sapiens (human): 6558Help
Entry
6558              CDS       T01001                                 

Gene name
SLC12A2, BSC, BSC2, NKCC1, PPP1R141
Definition
solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Orthology
K10951  
solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Pancreatic secretion
Vibrio cholerae infection
Drug target
Furosemide: 
Bumetanide: 
Piretanide: 
Torasemide: 
Etacrynic acid: 
Muzolimine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    6558 (SLC12A2)
   04972 Pancreatic secretion
    6558 (SLC12A2)
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    6558 (SLC12A2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6558 (SLC12A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q23.3
AA seq 1212 aa AA seqDB search
MEPRPTAPSSGAPGLAGVGETPSAAALAAARVELPGTAVPSVPEDAAPASRDGGGVRDEG
PAAAGDGLGRPLGPTPSQSRFQVDLVSENAGRAAAAAAAAAAAAAAAGAGAGAKQTPADG
EASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLS
EGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLR
PSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESKGVVKFGWIKGVLVRCMLNIW
GVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTITGLSTSAIATNGFVRGGGAYYLISRSL
GPEFGGAIGLIFAFANAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVIL
LGISVAGMEWEAKAQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPD
FREEETFFSVFAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVYVGIAVSV
GSCVVRDATGNVNDTIVTELTNCTSAACKLNFDFSSCESSPCSYGLMNNFQVMSMVSGFT
PLISAGIFSATLSSALASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFL
IALGFILIAELNVIAPIISNFFLASYALINFSVFHASLAKSPGWRPAFKYYNMWISLLGA
ILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNALQHSIRLSGV
EDHVKNFRPQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQA
KYQRWLIKNKMKAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDV
DMYINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKS
DLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQG
KNTIDVWWLFDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFR
IDFSDIMVLGDINTKPKKENIIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELE
LYKTKTYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPILLV
RGNHQSVLTFYS
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcggcccacggcgccctcctccggcgccccgggactggccggggtcggggag
acgccgtcagccgctgcgctggccgcagccagggtggaactgcccggcacggctgtgccc
tcggtgccggaggatgctgcgcccgcgagccgggacggcggcggggtccgcgatgagggc
cccgcggcggccggggacgggctgggcagacccttggggcccaccccgagccagagccgt
ttccaggtggacctggtttccgagaacgccgggcgggccgctgctgcggcggcggcggcg
gcggcggcagcggcggcggctggtgctggggcgggggccaagcagacccccgcggacggg
gaagccagcggcgagagcgagccggctaaaggcagcgaggaagccaagggccgcttccgc
gtgaacttcgtggacccagctgcctcctcgtcggctgaagacagcctgtcagatgctgcc
ggggtcggagtcgacgggcccaacgtgagcttccagaacggcggggacacggtgctgagc
gagggcagcagcctgcactccggcggcggcggcggcagtgggcaccaccagcactactat
tatgatacccacaccaacacctactacctgcgcaccttcggccacaacaccatggacgct
gtgcccaggatcgatcactaccggcacacagccgcgcagctgggcgagaagctgctccgg
cctagcctggcggagctccacgacgagctggaaaaggaaccttttgaggatggctttgca
aatggggaagaaagtactccaaccagagatgctgtggtcacgtatactgcagaaagtaaa
ggagtcgtgaagtttggctggatcaagggtgtattagtacgttgtatgttaaacatttgg
ggtgtgatgcttttcattagattgtcatggattgtgggtcaagctggaataggtctatca
gtccttgtaataatgatggccactgttgtgacaactatcacaggattgtctacttcagca
atagcaactaatggatttgtaagaggaggaggagcatattatttaatatctagaagtcta
gggccagaatttggtggtgcaattggtctaatcttcgcctttgccaacgctgttgcagtt
gctatgtatgtggttggatttgcagaaaccgtggtggagttgcttaaggaacattccata
cttatgatagatgaaatcaatgatatccgaattattggagccattacagtcgtgattctt
ttaggtatctcagtagctggaatggagtgggaagcaaaagctcagattgttcttttggtg
atcctacttcttgctattggtgatttcgtcataggaacatttatcccactggagagcaag
aagccaaaagggttttttggttataaatctgaaatatttaatgagaactttgggcccgat
tttcgagaggaagagactttcttttctgtatttgccatcttttttcctgctgcaactggt
attctggctggagcaaatatctcaggtgatcttgcagatcctcagtcagccatacccaaa
ggaacactcctagccattttaattactacattggtttacgtaggaattgcagtatctgta
ggttcttgtgttgttcgagatgccactggaaacgttaatgacactatcgtaacagagcta
acaaactgtacttctgcagcctgcaaattaaactttgatttttcatcttgtgaaagcagt
ccttgttcctatggcctaatgaacaacttccaggtaatgagtatggtgtcaggatttaca
ccactaatttctgcaggtatattttcagccactctttcttcagcattagcatccctagtg
agtgctcccaaaatatttcaggctctatgtaaggacaacatctacccagctttccagatg
tttgctaaaggttatgggaaaaataatgaacctcttcgtggctacatcttaacattctta
attgcacttggattcatcttaattgctgaactgaatgttattgcaccaattatctcaaac
ttcttccttgcatcatatgcattgatcaatttttcagtattccatgcatcacttgcaaaa
tctccaggatggcgtcctgcattcaaatactacaacatgtggatatcacttcttggagca
attctttgttgcatagtaatgttcgtcattaactggtgggctgcattgctaacatatgtg
atagtccttgggctgtatatttatgttacctacaaaaaaccagatgtgaattggggatcc
tctacacaagccctgacttacctgaatgcactgcagcattcaattcgtctttctggagtg
gaagaccacgtgaaaaactttaggccacagtgtcttgttatgacaggtgctccaaactca
cgtccagctttacttcatcttgttcatgatttcacaaaaaatgttggtttgatgatctgt
ggccatgtacatatgggtcctcgaagacaagccatgaaagagatgtccatcgatcaagcc
aaatatcagcgatggcttattaagaacaaaatgaaggcattttatgctccagtacatgca
gatgacttgagagaaggtgcacagtatttgatgcaggctgctggtcttggtcgtatgaag
ccaaacacacttgtccttggatttaagaaagattggttgcaagcagatatgagggatgtg
gatatgtatataaacttatttcatgatgcttttgacatacaatatggagtagtggttatt
cgcctaaaagaaggtctggatatatctcatcttcaaggacaagaagaattattgtcatca
caagagaaatctcctggcaccaaggatgtggtagtaagtgtggaatatagtaaaaagtcc
gatttagatacttccaaaccactcagtgaaaaaccaattacacacaaagttgaggaagag
gatggcaagactgcaactcaaccactgttgaaaaaagaatccaaaggccctattgtgcct
ttaaatgtagctgaccaaaagcttcttgaagctagtacacagtttcagaaaaaacaagga
aagaatactattgatgtctggtggctttttgatgatggaggtttgaccttattgatacct
taccttctgacgaccaagaaaaaatggaaagactgtaagatcagagtattcattggtgga
aagataaacagaatagaccatgaccggagagcgatggctactttgcttagcaagttccgg
atagacttttctgatatcatggttctaggagatatcaataccaaaccaaagaaagaaaat
attatagcttttgaggaaatcattgagccatacagacttcatgaagatgataaagagcaa
gatattgcagataaaatgaaagaagatgaaccatggcgaataacagataatgagcttgaa
ctttataagaccaagacataccggcagatcaggttaaatgagttattaaaggaacattca
agcacagctaatattattgtcatgagtctcccagttgcacgaaaaggtgctgtgtctagt
gctctctacatggcatggttagaagctctatctaaggacctaccaccaatcctcctagtt
cgtgggaatcatcagagtgtccttaccttctattcataa

DBGET integrated database retrieval system