KEGG   Homo sapiens (human): 6565Help
Entry
6565              CDS       T01001                                 

Gene name
SLC15A2, PEPT2
Definition
(RefSeq) solute carrier family 15 member 2
  KO
K14637  
solute carrier family 15 (oligopeptide transporter), member 2
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC15: Proton oligopeptide cotransporter
   6565 (SLC15A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13.33
AA seq 729 aa AA seqDB search
MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSY
YGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV
YVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEER
TRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSK
IYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT
RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFD
FVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHS
VQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVG
EDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED
IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIV
LVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMI
KLETKKTKL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctttccagaaaaatgagtccaaggaaactcttttttcacctgtctccattgaa
gaggtaccacctcgaccacctagccctccaaagaagccatctccgacaatctgtggctcc
aactatccactgagcattgccttcattgtggtgaatgaattctgcgagcgcttttcctat
tatggaatgaaagctgtgctgatcctgtatttcctgtatttcctgcactggaatgaagat
acctccacatctatataccatgccttcagcagcctctgttattttactcccatcctggga
gcagccattgctgactcgtggttgggaaaattcaagacaatcatctatctctccttggtg
tatgtgcttggccatgtgatcaagtccttgggtgccttaccaatactgggaggacaagtg
gtacacacagtcctatcattgatcggcctgagtctaatagctttggggacaggaggcatc
aaaccctgtgtggcagcttttggtggagaccagtttgaagaaaaacatgcagaggaacgg
actagatacttctcagtcttctacctgtccatcaatgcagggagcttgatttctacattt
atcacacccatgctgagaggagatgtgcaatgttttggagaagactgctatgcattggct
tttggagttccaggactgctcatggtaattgcacttgttgtgtttgcaatgggaagcaaa
atatacaataaaccaccccctgaaggaaacatagtggctcaagttttcaaatgtatctgg
tttgctatttccaatcgtttcaagaaccgttctggagacattccaaagcgacagcactgg
ctagactgggcggctgagaaatatccaaagcagctcattatggatgtaaaggcactgacc
agggtactattcctttatatcccattgcccatgttctgggctcttttggatcagcagggt
tcacgatggactttgcaagccatcaggatgaataggaatttggggttttttgtgcttcag
ccggaccagatgcaggttctaaatccccttctggttcttatcttcatcccgttgtttgac
tttgtcatttatcgtctggtctccaagtgtggaattaacttctcatcacttaggaaaatg
gctgttggtatgatcctagcatgcctggcatttgcagttgcggcagctgtagagataaaa
ataaatgaaatggccccagcccagccaggtccccaggaggttttcctacaagtcttgaat
ctggcagatgatgaggtgaaggtgacagtggtgggaaatgaaaacaattctctgttgata
gagtccatcaaatcctttcagaaaacaccacactattccaaactgcacctgaaaacaaaa
agccaggattttcacttccacctgaaatatcacaatttgtctctctacactgagcattct
gtgcaggagaagaactggtacagtcttgtcattcgtgaagatgggaacagtatctccagc
atgatggtaaaggatacagaaagcagaacaaccaatgggatgacaaccgtgaggtttgtt
aacactttgcataaagatgtcaacatctccctgagtacagatacctctctcaatgttggt
gaagactatggtgtgtctgcttatagaactgtgcaaagaggagaataccctgcagtgcac
tgtagaacagaagataagaacttttctctgaatttgggtcttctagactttggtgcagca
tatctgtttgttattactaataacaccaatcagggtcttcaggcctggaagattgaagac
attccagccaacaaaatgtccattgcgtggcagctaccacaatatgccctggttacagct
ggggaggtcatgttctctgtcacaggtcttgagttttcttattctcaggctccctctagc
atgaaatctgtgctccaggcagcttggctattgacaattgcagttgggaatatcatcgtg
cttgttgtggcacagttcagtggcctggtacagtgggccgaattcattttgttttcctgc
ctcctgctggtgatctgcctgatcttctccatcatgggctactactatgttcctgtaaag
acagaggatatgcggggtccagcagataagcacattcctcacatccaggggaacatgatc
aaactagagaccaagaagacaaaactctga

DBGET integrated database retrieval system