KEGG   Homo sapiens (human): 659Help
Entry
659               CDS       T01001                                 

Gene name
BMPR2, BMPR-II, BMPR3, BMR2, BRK-3, POVD1, PPH1, T-ALK
Definition
(RefSeq) bone morphogenetic protein receptor type 2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05206  MicroRNAs in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00679  BMP signaling
Disease
H01619  Primary pulmonary hypertension (PPH)
H01621  Pulmonary arterial hypertension (PAH)
H01866  Pulmonary veno-occlusive disease and pulmonary capillary hemangiomatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    659 (BMPR2)
   04390 Hippo signaling pathway
    659 (BMPR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    659 (BMPR2)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    659 (BMPR2)
 Organismal Systems
  Development
   04360 Axon guidance
    659 (BMPR2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    659 (BMPR2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    659 (BMPR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     659 (BMPR2)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   659 (BMPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH Cadherin_C_2 FTA2
Motif
Other DBs
NCBI-GeneID: 659
NCBI-ProteinID: NP_001195
OMIM: 600799
HGNC: 1078
Ensembl: ENSG00000204217
Vega: OTTHUMG00000133617
Pharos: Q13873(Tchem)
UniProt: Q13873
Structure
PDB: 

Jmol
Position
2q33.1-q33.2
AA seq 1038 aa AA seqDB search
MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC
TDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETNLHTTNVAQSIGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEATGQ
QDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVT
HRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQIGEST
QDGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTESLDCEVNNNGSNRAVHSKSSTAVYLA
EGGTATTMVSKDIGMNCL
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctcgctgcagcggccctggcgggtgccctggctaccatggaccatcctgctg
gtcagcactgcggctgcttcgcagaatcaagaacggctatgtgcgtttaaagatccgtat
cagcaagaccttgggataggtgagagtagaatctctcatgaaaatgggacaatattatgc
tcgaaaggtagcacctgctatggcctttgggagaaatcaaaaggggacataaatcttgta
aaacaaggatgttggtctcacattggagatccccaagagtgtcactatgaagaatgtgta
gtaactaccactcctccctcaattcagaatggaacataccgtttctgctgttgtagcaca
gatttatgtaatgtcaactttactgagaattttccacctcctgacacaacaccactcagt
ccacctcattcatttaaccgagatgagacaataatcattgctttggcatcagtctctgta
ttagctgttttgatagttgccttatgctttggatacagaatgttgacaggagaccgtaaa
caaggtcttcacagtatgaacatgatggaggcagcagcatccgaaccctctcttgatcta
gataatctgaaactgttggagctgattggccgaggtcgatatggagcagtatataaaggc
tccttggatgagcgtccagttgctgtaaaagtgttttcctttgcaaaccgtcagaatttt
atcaacgaaaagaacatttacagagtgcctttgatggaacatgacaacattgcccgcttt
atagttggagatgagagagtcactgcagatggacgcatggaatatttgcttgtgatggag
tactatcccaatggatctttatgcaagtatttaagtctccacacaagtgactgggtaagc
tcttgccgtcttgctcattctgttactagaggactggcttatcttcacacagaattacca
cgaggagatcattataaacctgcaatttcccatcgagatttaaacagcagaaatgtccta
gtgaaaaatgatggaacctgtgttattagtgactttggactgtccatgaggctgactgga
aatagactggtgcgcccaggggaggaagataatgcagccataagcgaggttggcactatc
agatatatggcaccagaagtgctagaaggagctgtgaacttgagggactgtgaatcagct
ttgaaacaagtagacatgtatgctcttggactaatctattgggagatatttatgagatgt
acagacctcttcccaggggaatccgtaccagagtaccagatggcttttcagacagaggtt
ggaaaccatcccacttttgaggatatgcaggttctcgtgtctagggaaaaacagagaccc
aagttcccagaagcctggaaagaaaatagcctggcagtgaggtcactcaaggagacaatc
gaagactgttgggaccaggatgcagaggctcggcttactgcacagtgtgctgaggaaagg
atggctgaacttatgatgatttgggaaagaaacaaatctgtgagcccaacagtcaatcca
atgtctactgctatgcagaatgaacgcaacctgtcacataataggcgtgtgccaaaaatt
ggtccttatccagattattcttcctcctcatacattgaagactctatccatcatactgac
agcatcgtgaagaatatttcctctgagcattctatgtccagcacacctttgactataggg
gaaaaaaaccgaaattcaattaactatgaacgacagcaagcacaagctcgaatccccagc
cctgaaacaagtgtcaccagcctctccaccaacacaacaaccacaaacaccacaggactc
acgccaagtactggcatgactactatatctgagatgccatacccagatgaaacaaatctg
cataccacaaatgttgcacagtcaattgggccaacccctgtctgcttacagctgacagaa
gaagacttggaaaccaacaagctagacccaaaagaagttgataagaacctcaaggaaagc
tctgatgagaatctcatggagcactctcttaaacagttcagtggcccagacccactgagc
agtactagttctagcttgctttacccactcataaaacttgcagtagaagcaactggacag
caggacttcacacagactgcaaatggccaagcatgtttgattcctgatgttctgcctact
cagatctatcctctccccaagcagcagaaccttcccaagagacctactagtttgcctttg
aacaccaaaaattcaacaaaagagccccggctaaaatttggcagcaagcacaaatcaaac
ttgaaacaagtcgaaactggagttgccaagatgaatacaatcaatgcagcagaacctcat
gtggtgacagtcaccatgaatggtgtggcaggtagaaaccacagtgttaactcccatgct
gccacaacccaatatgccaatgggacagtactatctggccaaacaaccaacatagtgaca
catagggcccaagaaatgttgcagaatcagtttattggtgaggacacccggctgaatatt
aattccagtcctgatgagcatgagcctttactgagacgagagcaacaagctggccatgat
gaaggtgttctggatcgtcttgtggacaggagggaacggccactagaaggtggccgaact
aattccaataacaacaacagcaatccatgttcagaacaagatgttcttgcacagggtgtt
ccaagcacagcagcagatcctgggccatcaaagcccagaagagcacagaggcctaattct
ctggatctttcagccacaaatgtcctggatggcagcagtatacagataggtgagtcaaca
caagatggcaaatcaggatcaggtgaaaagatcaagaaacgtgtgaaaactccctattct
cttaagcggtggcgcccctccacctgggtcatctccactgaatcgctggactgtgaagtc
aacaataatggcagtaacagggcagttcattccaaatccagcactgctgtttaccttgca
gaaggaggcactgctacaaccatggtgtctaaagatataggaatgaactgtctgtga

DBGET integrated database retrieval system