KEGG   Homo sapiens (human): 6608Help
Entry
6608              CDS       T01001                                 

Gene name
SMO, FZD11, Gx, SMOH
Definition
smoothened, frizzled class receptor
Orthology
K06226  
smoothened
Organism
hsa  Homo sapiens (human)
Pathway
Hedgehog signaling pathway
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Disease
H00039  
Basal cell carcinoma
Drug target
Vismodegib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    6608 (SMO)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6608 (SMO)
   05205 Proteoglycans in cancer
    6608 (SMO)
   05217 Basal cell carcinoma
    6608 (SMO)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    6608 (SMO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q32.3
AA seq 787 aa AA seqDB search
MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPP
LSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKA
TLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAE
ISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWG
AGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTEL
MDADSDF
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcccgcccagcgcgggggccggagctcccgctcctggggctgctgctgctg
ctgctgctgggggacccgggccggggggcggcctcgagcgggaacgcgaccgggcctggg
cctcggagcgcgggcgggagcgcgaggaggagcgcggcggtgactggccctccgccgccg
ctgagccactgcggccgggctgccccctgcgagccgctgcgctacaacgtgtgcctgggc
tcggtgctgccctacggggccacctccacactgctggccggagactcggactcccaggag
gaagcgcacggcaagctcgtgctctggtcgggcctccggaatgccccccgctgctgggca
gtgatccagcccctgctgtgtgccgtatacatgcccaagtgtgagaatgaccgggtggag
ctgcccagccgtaccctctgccaggccacccgaggcccctgtgccatcgtggagagggag
cggggctggcctgacttcctgcgctgcactcctgaccgcttccctgaaggctgcacgaat
gaggtgcagaacatcaagttcaacagttcaggccagtgcgaagtgcccttggttcggaca
gacaaccccaagagctggtacgaggacgtggagggctgcggcatccagtgccagaacccg
ctcttcacagaggctgagcaccaggacatgcacagctacatcgcggccttcggggccgtc
acgggcctctgcacgctcttcaccctggccacattcgtggctgactggcggaactcgaat
cgctaccctgctgttattctcttctacgtcaatgcgtgcttctttgtgggcagcattggc
tggctggcccagttcatggatggtgcccgccgagagatcgtctgccgtgcagatggcacc
atgaggcttggggagcccacctccaatgagactctgtcctgcgtcatcatctttgtcatc
gtgtactacgccctgatggctggtgtggtttggtttgtggtcctcacctatgcctggcac
acttccttcaaagccctgggcaccacctaccagcctctctcgggcaagacctcctacttc
cacctgctcacctggtcactcccctttgtcctcactgtggcaatccttgctgtggcgcag
gtggatggggactctgtgagtgggatttgttttgtgggctacaagaactaccgataccgt
gcgggcttcgtgctggccccaatcggcctggtgctcatcgtgggaggctacttcctcatc
cgaggagtcatgactctgttctccatcaagagcaaccaccccgggctgctgagtgagaag
gctgccagcaagatcaacgagaccatgctgcgcctgggcatttttggcttcctggccttt
ggctttgtgctcattaccttcagctgccacttctacgacttcttcaaccaggctgagtgg
gagcgcagcttccgggactatgtgctatgtcaggccaatgtgaccatcgggctgcccacc
aagcagcccatccctgactgtgagatcaagaatcgcccgagccttctggtggagaagatc
aacctgtttgccatgtttggaactggcatcgccatgagcacctgggtctggaccaaggcc
acgctgctcatctggaggcgtacctggtgcaggttgactgggcagagtgacgatgagcca
aagcggatcaagaagagcaagatgattgccaaggccttctctaagcggcacgagctcctg
cagaacccaggccaggagctgtccttcagcatgcacactgtgtcccacgacgggcccgtg
gcgggcttggcctttgacctcaatgagccctcagctgatgtctcctctgcctgggcccag
catgtcaccaagatggtggctcggagaggagccatactgccccaggatatttctgtcacc
cctgtggcaactccagtgcccccagaggaacaagccaacctgtggctggttgaggcagag
atctccccagagctgcagaagcgcctgggccggaagaagaagaggaggaagaggaagaag
gaggtgtgcccgctggcgccgccccctgagcttcacccccctgcccctgcccccagtacc
attcctcgactgcctcagctgccccggcagaaatgcctggtggctgcaggtgcctgggga
gctggggactcttgccgacagggagcgtggaccctggtctccaacccattctgcccagag
cccagtccccctcaggatccatttctgcccagtgcaccggcccccgtggcatgggctcat
ggccgccgacagggcctggggcctattcactcccgcaccaacctgatggacacagaactc
atggatgcagactcggacttctga

DBGET integrated database retrieval system