KEGG   Homo sapiens (human): 6608Help
Entry
6608              CDS       T01001                                 

Gene name
SMO, CRJS, FZD11, Gx, SMOH
Definition
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04360  Axon guidance
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
Module
hsa_M00678  Hedgehog signaling
Network
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00039  Basal cell carcinoma
H01556  Meningioma
H01667  Medulloblastoma
Drug target
Glasdegib: D10636
Saridegib (DG01274): D10324 D10325
Sonidegib (DG01854): D10119 D10729
Taladegib: D10671
Vismodegib: D09992
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    6608 (SMO)
 Organismal Systems
  Development
   04360 Axon guidance
    6608 (SMO)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6608 (SMO)
   05205 Proteoglycans in cancer
    6608 (SMO)
   05217 Basal cell carcinoma
    6608 (SMO)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    6608 (SMO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 6608
NCBI-ProteinID: NP_005622
OMIM: 601500
HGNC: 11119
Ensembl: ENSG00000128602
Vega: OTTHUMG00000158421
Pharos: Q99835(Tclin)
UniProt: Q99835
Position
7q32.1
AA seq 787 aa AA seqDB search
MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPP
LSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKA
TLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAE
ISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWG
AGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTEL
MDADSDF
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcccgcccagcgcgggggccggagctcccgctcctggggctgctgctgctg
ctgctgctgggggacccgggccggggggcggcctcgagcgggaacgcgaccgggcctggg
cctcggagcgcgggcgggagcgcgaggaggagcgcggcggtgactggccctccgccgccg
ctgagccactgcggccgggctgccccctgcgagccgctgcgctacaacgtgtgcctgggc
tcggtgctgccctacggggccacctccacactgctggccggagactcggactcccaggag
gaagcgcacggcaagctcgtgctctggtcgggcctccggaatgccccccgctgctgggca
gtgatccagcccctgctgtgtgccgtatacatgcccaagtgtgagaatgaccgggtggag
ctgcccagccgtaccctctgccaggccacccgaggcccctgtgccatcgtggagagggag
cggggctggcctgacttcctgcgctgcactcctgaccgcttccctgaaggctgcacgaat
gaggtgcagaacatcaagttcaacagttcaggccagtgcgaagtgcccttggttcggaca
gacaaccccaagagctggtacgaggacgtggagggctgcggcatccagtgccagaacccg
ctcttcacagaggctgagcaccaggacatgcacagctacatcgcggccttcggggccgtc
acgggcctctgcacgctcttcaccctggccacattcgtggctgactggcggaactcgaat
cgctaccctgctgttattctcttctacgtcaatgcgtgcttctttgtgggcagcattggc
tggctggcccagttcatggatggtgcccgccgagagatcgtctgccgtgcagatggcacc
atgaggcttggggagcccacctccaatgagactctgtcctgcgtcatcatctttgtcatc
gtgtactacgccctgatggctggtgtggtttggtttgtggtcctcacctatgcctggcac
acttccttcaaagccctgggcaccacctaccagcctctctcgggcaagacctcctacttc
cacctgctcacctggtcactcccctttgtcctcactgtggcaatccttgctgtggcgcag
gtggatggggactctgtgagtgggatttgttttgtgggctacaagaactaccgataccgt
gcgggcttcgtgctggccccaatcggcctggtgctcatcgtgggaggctacttcctcatc
cgaggagtcatgactctgttctccatcaagagcaaccaccccgggctgctgagtgagaag
gctgccagcaagatcaacgagaccatgctgcgcctgggcatttttggcttcctggccttt
ggctttgtgctcattaccttcagctgccacttctacgacttcttcaaccaggctgagtgg
gagcgcagcttccgggactatgtgctatgtcaggccaatgtgaccatcgggctgcccacc
aagcagcccatccctgactgtgagatcaagaatcgcccgagccttctggtggagaagatc
aacctgtttgccatgtttggaactggcatcgccatgagcacctgggtctggaccaaggcc
acgctgctcatctggaggcgtacctggtgcaggttgactgggcagagtgacgatgagcca
aagcggatcaagaagagcaagatgattgccaaggccttctctaagcggcacgagctcctg
cagaacccaggccaggagctgtccttcagcatgcacactgtgtcccacgacgggcccgtg
gcgggcttggcctttgacctcaatgagccctcagctgatgtctcctctgcctgggcccag
catgtcaccaagatggtggctcggagaggagccatactgccccaggatatttctgtcacc
cctgtggcaactccagtgcccccagaggaacaagccaacctgtggctggttgaggcagag
atctccccagagctgcagaagcgcctgggccggaagaagaagaggaggaagaggaagaag
gaggtgtgcccgctggcgccgccccctgagcttcacccccctgcccctgcccccagtacc
attcctcgactgcctcagctgccccggcagaaatgcctggtggctgcaggtgcctgggga
gctggggactcttgccgacagggagcgtggaccctggtctccaacccattctgcccagag
cccagtccccctcaggatccatttctgcccagtgcaccggcccccgtggcatgggctcat
ggccgccgacagggcctggggcctattcactcccgcaccaacctgatggacacagaactc
atggatgcagactcggacttctga

DBGET integrated database retrieval system