KEGG   Homo sapiens (human): 6609Help
Entry
6609              CDS       T01001                                 

Gene name
SMPD1, ASM, ASMASE, NPD
Definition
(RefSeq) sphingomyelin phosphodiesterase 1
  KO
K12350  
sphingomyelin phosphodiesterase [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway
Lysosome
Necroptosis
Disease
H00137  
Niemann-Pick disease (NPD) typeA and B
H00424  
Defects in the degradation of sphingomyelin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    6609 (SMPD1)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    6609 (SMPD1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    6609 (SMPD1)
  Cell growth and death
   04217 Necroptosis
    6609 (SMPD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     6609 (SMPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P17405(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.4
AA seq 630 aa AA seqDB search
MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE
AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKEPNVARVGSVAIKL
CNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLP
TVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRP
GAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTTV
TALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALR
TLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDK
VHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVA
FLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRA
RETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSA
RADSPALCRHLMPDGSLPEAQSLWPRPLFC
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctacggagcgtcactccgccagagctgccccaggtccggccgggagcaggga
caagacgggaccgccggagcccccggactcctttggatgggcctggtgctggcgctggcg
ctggcgctggcgctggcgctggctctgtctgactctcgggttctctgggctccggcagag
gctcaccctctttctccccaaggccatcctgccaggttacatcgcatagtgccccggctc
cgagatgtctttgggtgggggaacctcacctgcccaatctgcaaaggtctattcaccgcc
atcaacctcgggctgaaggaacccaatgtggctcgcgtgggctccgtggccatcaagctg
tgcaatctgctgaagatagcaccacctgccgtgtgccaatccattgtccacctctttgag
gatgacatggtggaggtgtggagacgctcagtgctgagcccatctgaggcctgtggcctg
ctcctgggctccacctgtgggcactgggacattttctcatcttggaacatctctttgcct
actgtgccgaagccgccccccaaaccccctagccccccagccccaggtgcccctgtcagc
cgcatcctcttcctcactgacctgcactgggatcatgactacctggagggcacggaccct
gactgtgcagacccactgtgctgccgccggggttctggcctgccgcccgcatcccggcca
ggtgccggatactggggcgaatacagcaagtgtgacctgcccctgaggaccctggagagc
ctgttgagtgggctgggcccagccggcccttttgatatggtgtactggacaggagacatc
cccgcacatgatgtctggcaccagactcgtcaggaccaactgcgggccctgaccaccgtc
acagcacttgtgaggaagttcctggggccagtgccagtgtaccctgctgtgggtaaccat
gaaagcacacctgtcaatagcttccctccccccttcattgagggcaaccactcctcccgc
tggctctatgaagcgatggccaaggcttgggagccctggctgcctgccgaagccctgcgc
accctcagaattggggggttctatgctctttccccataccccggtctccgcctcatctct
ctcaatatgaatttttgttcccgtgagaacttctggctcttgatcaactccacggatccc
gcaggacagctccagtggctggtgggggagcttcaggctgctgaggatcgaggagacaaa
gtgcatataattggccacattcccccagggcactgtctgaagagctggagctggaattat
taccgaattgtagccaggtatgagaacaccctggctgctcagttctttggccacactcat
gtggatgaatttgaggtcttctatgatgaagagactctgagccggccgctggctgtagcc
ttcctggcacccagtgcaactacctacatcggccttaatcctggttaccgtgtgtaccaa
atagatggaaactactccgggagctctcacgtggtcctggaccatgagacctacatcctg
aatctgacccaggcaaacataccgggagccataccgcactggcagcttctctacagggct
cgagaaacctatgggctgcccaacacactgcctaccgcctggcacaacctggtatatcgc
atgcggggcgacatgcaacttttccagaccttctggtttctctaccataagggccaccca
ccctcggagccctgtggcacgccctgccgtctggctactctttgtgcccagctctctgcc
cgtgctgacagccctgctctgtgccgccacctgatgccagatgggagcctcccagaggcc
cagagcctgtggccaaggccactgttttgctag

DBGET integrated database retrieval system