KEGG   Homo sapiens (human): 6610Help
Entry
6610              CDS       T01001                                 

Gene name
SMPD2, ISC1, NSMASE, NSMASE1
Definition
sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase) (EC:3.1.4.12)
Orthology
K12351  
sphingomyelin phosphodiesterase 2 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hsa00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q21
AA seq 423 aa AA seqDB search
MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVWSEQDFQYLR
QKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHGDWFSGKAVGL
LVLHLSGMVLNAYVTHLHAEYNRQKDIYLAHRVAQAWELAQFIHHTSKKADVVLLCGDLN
MHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYV
LYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSSTHGPAERS
PLMCVLKEAWTELGLGMAQARWWATFASYVIGLGLLLLALLCVLAAGGGAGEAAILLWTP
SVGLVLWAGAFYLFHVQEVNGLYRAQAELQHVLGRAREAQDLGPEPQPALLLGQQEGDRT
KEQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccaacttctccctgcgactgcggatcttcaacctcaactgctggggcattccg
tacttgagcaagcaccgggccgaccgcatgaggcgcctgggagactttctgaaccaggag
agcttcgacctggctttgctggaggaggtgtggagtgagcaggacttccagtacctgaga
cagaagctgtcacctacctacccagctgcacaccacttccggagcggaatcattggcagt
ggcctctgtgtcttctccaaacatccaatccaggagcttacccagcacatctacactctc
aatggctacccctacatgatccatcatggtgactggttcagtgggaaggctgtggggctg
ctggtgctccatctaagtggcatggtgctcaacgcctatgtgacccatctccatgccgaa
tacaatcgacagaaggacatctacctagcacatcgtgtggcccaagcttgggaattggcc
cagttcatccaccacacatccaagaaggcagacgtggttctgttgtgtggagacctcaac
atgcacccagaagacctgggctgctgcctgctgaaggagtggacagggcttcatgatgcc
tatcttgaaactcgggacttcaagggctctgaggaaggcaacacaatggtacccaagaac
tgctacgtcagccagcaggagctgaagccatttccctttggtgtccgcattgactacgtg
ctttacaaggcagtttctgggttttacatctcctgtaagagttttgaaaccactacaggc
tttgaccctcacaggggcacccccctctctgatcatgaagccctgatggctactctgttt
gtgaggcacagccccccacagcagaaccccagctctacccacggaccagcagagaggtcg
ccgttgatgtgtgtgctaaaggaggcctggacggagctgggtctgggcatggctcaggct
cgctggtgggccaccttcgctagctatgtgattggcctggggctgcttctcctggcactg
ctgtgtgtcctggcggctggaggaggggccggggaagctgccatactgctctggaccccc
agtgtagggctggtgctgtgggcaggtgcattctacctcttccacgtacaggaggtcaat
ggcttatatagggcccaggctgagctccagcatgtgctaggaagggcaagggaggcccag
gatctgggcccagagcctcagccagccctactcctggggcagcaggagggggacagaact
aaagaacaataa

DBGET integrated database retrieval system