KEGG   Homo sapiens (human): 6610Help
Entry
6610              CDS       T01001                                 

Gene name
SMPD2, ISC1, NSMASE, NSMASE1
Definition
(RefSeq) sphingomyelin phosphodiesterase 2
  KO
K12351  sphingomyelin phosphodiesterase 2 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Drug target
Olipudase alfa: D10820
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    6610 (SMPD2)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    6610 (SMPD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     6610 (SMPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 6610
NCBI-ProteinID: NP_003071
OMIM: 603498
HGNC: 11121
Ensembl: ENSG00000135587
Vega: OTTHUMG00000015348
Pharos: O60906(Tchem)
UniProt: O60906
Position
6q21
AA seq 423 aa AA seqDB search
MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVWSEQDFQYLR
QKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHGDWFSGKAVGL
LVLHLSGMVLNAYVTHLHAEYNRQKDIYLAHRVAQAWELAQFIHHTSKKADVVLLCGDLN
MHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYV
LYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSSTHGPAERS
PLMCVLKEAWTELGLGMAQARWWATFASYVIGLGLLLLALLCVLAAGGGAGEAAILLWTP
SVGLVLWAGAFYLFHVQEVNGLYRAQAELQHVLGRAREAQDLGPEPQPALLLGQQEGDRT
KEQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccaacttctccctgcgactgcggatcttcaacctcaactgctggggcattccg
tacttgagcaagcaccgggccgaccgcatgaggcgcctgggagactttctgaaccaggag
agcttcgacctggctttgctggaggaggtgtggagtgagcaggacttccagtacctgaga
cagaagctgtcacctacctacccagctgcacaccacttccggagcggaatcattggcagt
ggcctctgtgtcttctccaaacatccaatccaggagcttacccagcacatctacactctc
aatggctacccctacatgatccatcatggtgactggttcagtgggaaggctgtggggctg
ctggtgctccatctaagtggcatggtgctcaacgcctatgtgacccatctccatgccgaa
tacaatcgacagaaggacatctacctagcacatcgtgtggcccaagcttgggaattggcc
cagttcatccaccacacatccaagaaggcagacgtggttctgttgtgtggagacctcaac
atgcacccagaagacctgggctgctgcctgctgaaggagtggacagggcttcatgatgcc
tatcttgaaactcgggacttcaagggctctgaggaaggcaacacaatggtacccaagaac
tgctacgtcagccagcaggagctgaagccatttccctttggtgtccgcattgactacgtg
ctttacaaggcagtttctgggttttacatctcctgtaagagttttgaaaccactacaggc
tttgaccctcacaggggcacccccctctctgatcatgaagccctgatggctactctgttt
gtgaggcacagccccccacagcagaaccccagctctacccacggaccagcagagaggtcg
ccgttgatgtgtgtgctaaaggaggcctggacggagctgggtctgggcatggctcaggct
cgctggtgggccaccttcgctagctatgtgattggcctggggctgcttctcctggcactg
ctgtgtgtcctggcggctggaggaggggccggggaagctgccatactgctctggaccccc
agtgtagggctggtgctgtgggcaggtgcattctacctcttccacgtacaggaggtcaat
ggcttatatagggcccaggctgagctccagcatgtgctaggaagggcaagggaggcccag
gatctgggcccagagcctcagccagccctactcctggggcagcaggagggggacagaact
aaagaacaataa

DBGET integrated database retrieval system