KEGG   Homo sapiens (human): 6627Help
Entry
6627              CDS       T01001                                 

Gene name
SNRPA1, Lea1
Definition
small nuclear ribonucleoprotein polypeptide A'
Orthology
K11092  
U2 small nuclear ribonucleoprotein A'
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U2-snRNP
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26.3
AA seq 255 aa AA seqDB search
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF
PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI
LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT
FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagctgacggcggagctgatcgagcaggcggcgcagtacaccaacgcggtgcgc
gaccgggagctggacctccgggggtataaaattcccgtcattgaaaatctaggtgctacg
ttagaccagtttgatgctattgatttttctgacaatgagatcaggaaactggatggtttt
cctttgttgagaagactgaaaacattgttagtgaacaacaacagaatatgccgtataggt
gagggacttgatcaggctctgccctgtctgacagaactcattctcaccaataatagtctc
gtggaactgggtgatctggaccctctggcatctctcaaatcgctgacttacctaagtatc
ctaagaaatccggtaaccaataagaagcattacagattgtatgtgatttataaagttccg
caagtcagagtactggatttccagaaagtgaaactaaaagagcgtcaggaagcagagaaa
atgttcaagggcaaacggggtgcacagcttgcaaaggatattgccaggagaagcaaaact
tttaatccaggtgctggtttgccaactgacaaaaagaaaggtgggccatctccaggggat
gtagaagcaatcaagaatgccatagcaaatgcttcaactctggctgaagtggagaggctg
aaggggttgctgcagtctggtcagatccctggcagagaacgcagatcagggcccactgat
gatggtgaagaagagatggaagaagacacagtcacaaacgggtcctga

DBGET integrated database retrieval system