KEGG   Homo sapiens (human): 6648Help
Entry
6648              CDS       T01001                                 

Gene name
SOD2, IPOB, MNSOD, MVCD6
Definition
(RefSeq) superoxide dismutase 2, mitochondrial (EC:1.15.1.1)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Peroxisome
Longevity regulating pathway
Longevity regulating pathway - multiple species
Huntington's disease
Disease
H01456  
Diabetic nephropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    6648 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    6648 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    6648 (SOD2)
   04213 Longevity regulating pathway - multiple species
    6648 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    6648 (SOD2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     6648 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q25.3
AA seq 222 aa AA seqDB search
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccgggcagtgtgcggcaccagcaggcagctggctccggttttggggtatctg
ggctccaggcagaagcacagcctccccgacctgccctacgactacggcgccctggaacct
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgtcaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcc
cagatagctcttcagcctgcactgaagttcaatggtggtggtcatatcaatcatagcatt
ttctggacaaacctcagccctaacggtggtggagaacccaaaggggagttgctggaagcc
atcaaacgtgactttggttcctttgacaagtttaaggagaagctgacggctgcatctgtt
ggtgtccaaggctcaggttggggttggcttggtttcaataaggaacggggacacttacaa
attgctgcttgtccaaatcaggatccactgcaaggaacaacaggccttattccactgctg
gggattgatgtgtgggagcacgcttactaccttcagtataaaaatgtcaggcctgattat
ctaaaagctatttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system