KEGG   Homo sapiens (human): 6667Help
Entry
6667              CDS       T01001                                 

Gene name
SP1
Definition
Sp1 transcription factor
Orthology
K04684  
transcription factor Sp1
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Estrogen signaling pathway
Huntington's disease
Transcriptional misregulation in cancer
Choline metabolism in cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    6667 (SP1)
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    6667 (SP1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    6667 (SP1)
   05202 Transcriptional misregulation in cancers
    6667 (SP1)
  Neurodegenerative diseases
   05016 Huntington's disease
    6667 (SP1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 ubiquitous factors
    6667 (SP1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    6667 (SP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.1
AA seq 737 aa AA seqDB search
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQGANGWQ
IISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVM
PNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAM
PNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISS
SGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSG
TNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQG
GQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQ
LQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPG
LQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENS
PDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLR
WHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTH
QNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGIN
VMQVADLQSINISGNGF
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaaaattgaaaaagga
gttggtggcaataatgggggcaatggtaatggtggtggtgccttttcacaggctcgaagt
agcagcacaggcagtagcagcagcactggaggaggagggcagggtgccaatggctggcag
atcatctcttcctcctctggggctacccctacctcaaaggaacagagtggcagcagtacc
aatggcagcaatggcagtgagtcttccaagaatcgcacagtctctggtgggcagtatgtt
gtggctgccgctcccaacttacagaaccagcaagttctgacaggactacctggagtgatg
cctaatattcagtatcaagtaatcccacagttccagaccgttgatgggcaacagctgcag
tttgctgccactggggcccaagtgcagcaggatggttctggtcaaatacagatcatacca
ggtgcaaaccaacagattatcacaaatcgaggaagtggaggcaacatcattgctgctatg
ccaaacctactccagcaggctgtccccctccaaggcctggctaataatgtactctcagga
cagactcagtatgtgaccaatgtaccagtggccctgaatgggaacatcaccttgctacct
gtcaacagcgtttctgcagctaccttgactcccagctctcaggcagtcacgatcagcagc
tctgggtcccaggagagtggctcacagcctgtcacctcagggactaccatcagttctgcc
agcttggtatcatcacaagccagttccagctcctttttcaccaatgccaatagctactca
actactactaccaccagcaacatgggaattatgaactttactaccagtggatcatcaggg
accaactctcaaggccagacaccccagagggtcagtgggctacaggggtctgatgctctg
aacatccagcaaaaccagacatctggaggctcattgcaagcaggccagcaaaaagaagga
gagcaaaaccagcagacacagcagcaacaaattcttatccagcctcagctagttcaaggg
ggacaggccctccaggccctccaagcagcaccattgtcagggcagacctttacaactcaa
gccatctcccaggaaaccctccagaacctccagcttcaggctgttccaaactctggtccc
atcatcatccggacaccaacagtggggcccaatggacaggtcagttggcagactctacag
ctgcagaacctccaagttcagaacccacaagcccaaacaatcaccttagccccaatgcag
ggtgtttccttggggcagaccagcagcagcaacaccactctcacacccattgcctcagct
gcttccattcctgctggcacagtcactgtgaatgctgctcaactctcctccatgccaggc
ctccagaccattaacctcagtgcattgggtacttcaggaatccaggtgcacccaattcaa
ggcctgccgttggctatagcaaatgccccaggtgatcatggagctcagcttggtctccat
ggggctggtggtgatggaatacatgatgacacagcaggtggagaggaaggagaaaacagc
ccagatgcccaaccccaagccggtcggaggacccggcgggaagcatgcacctgcccctac
tgtaaagacagtgaaggaaggggctcgggggatcctggcaaaaagaaacagcatatttgc
cacatccaaggctgtgggaaagtgtatggcaagacctctcacctgcgggcacacttgcgc
tggcatacaggcgagaggccatttatgtgtacctggtcatactgtgggaaacgcttcaca
cgttcggatgagctacagaggcacaaacgtacacacacaggtgagaagaaatttgcctgc
cctgagtgtcctaagcgcttcatgaggagtgaccacctgtcaaaacatatcaagacccac
cagaataagaagggaggcccaggtgtagctctgagtgtgggcactttgcccctggacagt
ggggcaggttcagaaggcagtggcactgccactccttcagcccttattaccaccaatatg
gtagccatggaggccatctgtccagagggcattgcccgtcttgccaacagtggcatcaac
gtcatgcaggtggcagatctgcagtccattaatatcagtggcaatggcttctga

DBGET integrated database retrieval system