KEGG   Homo sapiens (human): 669Help
Entry
669               CDS       T01001                                 

Gene name
BPGM, DPGM
Definition
2,3-bisphosphoglycerate mutase (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01837  
bisphosphoglycerate mutase [EC:5.4.2.4 5.4.2.11 3.1.3.13]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Disease
H00664  
Anemia due to disorders of glycolytic enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    669 (BPGM)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    669 (BPGM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.13  bisphosphoglycerate phosphatase
     669 (BPGM)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.4  bisphosphoglycerate mutase
     669 (BPGM)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     669 (BPGM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q33
AA seq 259 aa AA seqDB search
MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVL
NRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYN
VTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRG
KTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEA
IQAAIKKVEDQGKVKQAKK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagtacaaacttattatgttaagacatggagagggtgcttggaataaggagaac
cgtttttgtagctgggtggatcagaaactcaacagcgaaggaatggaggaagctcggaac
tgtgggaagcaactcaaagcgttaaactttgagtttgatcttgtattcacatctgtcctt
aatcggtccattcacacagcctggctgatcctggaagagctaggccaggaatgggtgcct
gtggaaagctcctggcgtctaaatgagcgtcactatggggccttgatcggtctcaacagg
gagcagatggctttgaatcatggtgaagaacaagtgaggctctggagaagaagctacaat
gtaaccccgcctcccattgaggagtctcatccttactaccaagaaatctacaacgaccgg
aggtataaagtatgcgatgtgcccttggatcaactgccacggtcggaaagcttaaaggat
gttctggagagactccttccctattggaatgaaaggattgctcccgaagtattacgtggc
aaaaccattctgatatctgctcatggaaatagcagtagggcactcctaaaacacctggaa
ggtatctcagatgaagacatcatcaacattactcttcctactggagtccccattcttctg
gaattggatgaaaacctgcgtgctgttgggcctcatcagttcctgggtgaccaagaggcg
atccaagcagccattaagaaagtagaagatcaaggaaaagtgaaacaagctaaaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system