KEGG   Homo sapiens (human): 6709Help
Entry
6709              CDS       T01001                                 

Gene name
SPTAN1, EIEE5, NEAS, SPTA2
Definition
(RefSeq) spectrin alpha, non-erythrocytic 1
  KO
K06114  
spectrin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Tight junction
Disease
H00606  
Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    6709 (SPTAN1)
  Cellular commiunity
   04530 Tight junction
    6709 (SPTAN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     6709 (SPTAN1)
  Intermediate filaments
   Intermediate filament-binding proteins
    6709 (SPTAN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.11
AA seq 2472 aa AA seqDB search
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERG
ACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEAL
LASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRD
TINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQ
NLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAA
ARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFT
VHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQ
FNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK
DQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKA
SAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSF
RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQW
IQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDN
KYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKS
GRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRET
ENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAF
DYVEFTRSLFVN
NT seq 7419 nt NT seq  +upstreamnt  +downstreamnt
atggacccaagtggggtcaaagtgctggaaacagcagaggacatccaggagaggcggcag
caggtcctagaccgataccaccgcttcaaggaactctcaacccttaggcgtcagaagctg
gaagattcctatcgattccagttctttcaaagagatgctgaagagctggagaaatggata
caggaaaaacttcagattgcatctgatgagaattataaagacccaaccaacttgcaggga
aagcttcagaagcatcaagcatttgaagctgaagtgcaggccaactcaggagccattgtt
aagctggatgaaactggaaacctgatgatctcagaagggcattttgcatctgaaaccata
cggacccgtttgatggagctgcaccgccagtgggaattacttttggagaagatgcgagaa
aaaggaatcaaactgctgcaggcccagaagttggtgcagtacttacgagaatgtgaggac
gtgatggactggatcaatgacaaggaagcaattgttacttctgaagagctgggccaggat
ctggagcatgtagaggttttacagaagaaatttgaagagtttcaaacagatatggctgct
catgaagaaagagttaatgaagtgaaccagtttgctgccaaactcatacaggagcagcac
cctgaggaggaactgatcaagactaagcaggatgaagtcaatgcagcctggcagcggctg
aagggcctggctctgcagaggcaggggaagctctttggggcagcagaagttcagcgcttt
aacagggatgtggatgagactatcagttggattaaggaaaaggagcagttaatggcctct
gatgattttggccgagacctggcaagtgttcaggctctgcttcggaagcacgagggtctg
gagagagatcttgctgctctagaagacaaggtcaaagccctgtgtgctgaggctgaccgc
ctgcaacagtcccaccctctgagtgcaacacagattcaagtgaagcgagaggaactgatt
acaaactgggagcagatccgcaccttggcggcagagagacatgcacggctcaatgattca
tacaggcttcaacgcttccttgctgacttccgtgacctcaccagctgggtgactgagatg
aaagccctcatcaatgcagatgagcttgccagtgatgtggctggggctgaagccctgcta
gatagacaccaagagcacaagggtgaaattgatgcccatgaagacagcttcaaatctgca
gatgaatctggacaggcactgcttgctgctggtcactatgcctcagatgaagtgagggag
aagctgaccgtcctttccgaggagagagcggcgctgctggagctgtgggagctgcgcagg
cagcagtacgagcagtgcatggacctgcagctcttctaccgggacactgagcaggtggac
aactggatgagcaagcaggaggcgttcctgttgaatgaagacttgggagattccttggat
agtgtggaagcgcttcttaagaagcacgaagactttgagaaatcccttagtgcccaggag
gaaaagattacagcattagatgaatttgcaaccaagctaattcagaacaaccactatgca
atggaagatgtggccactcgccgagatgctctgttgagccgccgcaatgcccttcacgag
agagccatgcgtcgccgggcccagctagccgattctttccatctgcagcagtttttccgt
gattctgatgagctcaagagttgggtcaatgagaagatgaaaactgccacagatgaagct
tataaagatccatccaacctacaaggaaaagtacagaagcatcaggcttttgaggctgag
ctctcagcaaaccagagccgaattgatgccttggagaaagctggccaaaagctgattgat
gtcaaccactatgccaaggatgaagtggcagctcgtatgaatgaggtgatcagtttgtgg
aagaaactgctagaggccactgaactgaaaggaataaagcttcgtgaagccaaccagcaa
cagcaatttaatcgcaatgttgaggatattgaattgtggctatatgaagtagaaggtcac
ttggcttcggatgattacggcaaagatcttaccaatgtgcagaacctccagaagaaacat
gccctgctagaggcagatgtggctgctcaccaggaccgaattgatggcatcaccattcag
gcccgccagttccaagatgctggccattttgatgcagaaaacatcaagaagaaacaggaa
gccctcgtggctcgctatgaggcactcaaggagcccatggttgcccggaagcagaagctg
gccgattctctgcggttgcagcagctcttccgggatgttgaggatgaggagacgtggatt
cgagagaaagagcccattgccgcatctaccaacagaggtaaggatttaattggggtccag
aatctgctaaagaaacatcaagccttacaagcagaaattgctggacatgaaccacgcatc
aaagcagttacacagaaggggaatgccatggtggaggaaggccattttgctgcagaggat
gtgaaggccaagcttcacgagctgaaccaaaagtgggaggcactgaaagccaaagcttcc
cagcgtcggcaggacctggaggactctctgcaggcccagcagtactttgctgatgctaac
gaggctgaatcctggatgcgggagaaggaacccattgtgggcagcactgactatggcaag
gacgaagactctgctgaggctctactgaagaaacacgaagctttgatgtcagatctcagt
gcctacggcagcagcatccaggctttgcgagaacaagcacagtcctgccggcaacaagtg
gcccccacggatgatgagactgggaaggagctggtcttggctctctacgactatcaggag
aagagtccccgagaggtcaccatgaagaagggagatatccttaccttactcaacagcacc
aacaaggattggtggaaagtggaagtgaacgatcgtcagggttttgtgccggctgcgtac
gtgaagaaattggaccccgcccagtcagcctcccgggagaatctcctggaggagcaaggc
agcatagcactgcggcaggagcagattgacaatcagacacgcataactaaggaggccggc
agtgtatctctgcgtatgaagcaggtggaagaactatatcattctctgctggaactgggt
gagaagcgtaaaggcatgttggagaagagttgcaagaagtttatgttgttccgtgaagcg
aatgaactacagcaatggatcaatgagaaggaagccgctctgacaagtgaggaggtcgga
gcagacttggagcaggttgaggtgctccagaagaagtttgatgacttccagaaggacctg
aaggccaatgagtcacggttgaaggacattaacaaggtagctgaagacctggagtctgaa
ggtctcatggcagaggaggtgcaggctgtgcaacaacaggaagtgtatggcatgatgccc
agggatgaaactgattccaagacagcctccccgtggaagtctgctcgtctgatggttcac
accgtggccacctttaattccatcaaggagctgaatgagcgctggcggtccctacagcag
ctggccgaggaacggagccagctcttgggcagcgcccatgaagtacagaggttccacaga
gatgctgatgaaaccaaagaatggattgaagagaagaatcaagctctaaacacagacaat
tatggacatgatctcgccagtgtccaggccctgcaacgcaagcatgagggcttcgagagg
gaccttgcggctctcggtgacaaggtaaactcccttggtgaaacagcagagcgcctgatc
cagtcccatcccgagtcagcagaagacctgcaggaaaagtgcacagagttaaaccaggcc
tggagcagcctggggaaacgtgcagatcagcgcaaggcaaagttgggtgactcccacgac
ctgcagcgcttccttagcgatttccgggacctcatgtcttggatcaatggaatacggggg
ttggtgtcctcagatgagctagccaaggatgtcaccggagctgaggcattgctggagcga
caccaggaacaccggacagaaatcgatgccagggctggcactttccaggcatttgagcag
tttggacagcagctgttggctcacggacactatgccagccctgagatcaagcagaaactt
gatattcttgaccaggagcgtgcagacctggagaaggcctgggttcagcgcaggatgatg
ctggatcagtgccttgaactgcagctgttccatcgggactgtgagcaagctgagaactgg
atggctgcccgggaggccttcttgaataccgaagacaaaggagactcactggacagcgta
gaggctctgatcaaaaaacatgaagactttgacaaagcgattaacgtccaggaagagaag
attgctgctctgcaggcctttgccgaccagctcatcgctgccggccattatgccaaggga
gacatttctagccggcgcaatgaggtcttggacaggtggcgacgtctgaaagcccagatg
attgagaaaaggtcaaagctaggagaatctcaaaccctccaacagttcagccgggatgtg
gatgagattgaggcttggatcagtgaaaaattgcaaacagcgagtgatgagtcgtacaag
gatcccaccaacatccagagcaagcaccagaagcaccaggcttttgaagcagagctgcat
gccaacgctgaccggatccgtggggttatcgacatgggcaactccctcattgaacgtgga
gcctgtgccggcagtgaggatgctgtcaaggcccgcctggctgccttagctgaccagtgg
cagttcttggtgcaaaagtcagcggaaaagagccagaaactgaaagaagccaacaagcag
cagaacttcaacacagggatcaaggactttgacttctggctgtctgaggtggaggccctg
ctggcatccgaagattatggcaaagacctggcttctgtgaacaacctgctgaaaaagcat
caactgctggaagcagatatatctgcccatgaggatcgcctgaaggacctgaacagccag
gcagacagcctgatgaccagcagtgccttcgacacctcccaagtaaaggacaagagggac
accatcaacgggcgcttccagaagatcaagagcatggcggcctcccggcgagccaagctg
aatgaatcccatcgcctgcaccagttcttccgggacatggatgacgaggagtcctggatc
aaggagaagaagctgctggtgggctcagaggactacggccgggacctaaccggcgtgcag
aacctgaggaagaagcacaagcggctggaagcagaactggctgcgcatgagccggctatt
cagggtgtcctggacactggcaagaagctgtccgatgacaacaccatcgggaaagaggag
atccagcagcggctggcgcagtttgtggagcactggaaagagctgaagcagctggcagct
gcccggggtcagcggctggaagagtccttggaatatcagcagtttgtagccaatgtggaa
gaggaagaagcctggatcaatgagaaaatgaccctggtggccagcgaagattatggcgac
actcttgccgccatccagggcttactgaagaaacatgaagcttttgagacagacttcacc
gtccacaaggatcgcgtgaatgatgtctgcaccaatggacaagacctcattaagaagaac
aatcaccatgaggagaacatctcttcaaagatgaagggcctgaacgggaaagtgtcagac
ctggagaaagctgcagcccagagaaaggcgaagctggatgagaactcggccttccttcag
ttcaactggaaggcggacgtggtggagtcctggatcggtgaaaaggagaacagcttgaag
acagatgattatggccgagacctgtcttctgtgcagacgctcctcaccaaacaggaaact
tttgacgctgggctgcaggccttccagcaggaaggcattgccaacatcactgccctcaaa
gatcagcttctcgccgccaaacacgttcagtccaaggccatcgaggcccggcacgcctcc
ctcatgaagaggtggagccagcttctggccaactcagccgcccgcaagaagaagcttctg
gaggctcagagtcacttccgcaaggtggaggacctcttcctgaccttcgccaaaaaggct
tctgccttcaacagctggtttgaaaatgcagaggaggacttaacagaccccgtgcgctgc
aactccttggaagaaatcaaagctttgcgcgaggcccacgacgccttccgctcctccctc
agctctgcccaggctgacttcaaccagctggccgagctggaccgccagatcaagagcttc
cgcgtagcctccaacccctacacctggtttaccatggaggccctggaggagacctggagg
aacctacagaaaatcatcaaggagagggagctggagctgcagaaggaacagcggcggcag
gaggagaacgacaagctgcgccaggagtttgcccagcacgccaacgccttccaccagtgg
atccaagagaccaggacatacctcctcgatgggtcctgtatggtggaagagtcggggacc
ctcgaatcccagcttgaagctaccaaacgcaagcaccaggaaatccgagccatgagaagt
cagctcaaaaagatcgaggacctgggggccgccatggaggaggccctcatcctggacaac
aagtacacggagcacagcaccgtgggcctcgcccagcagtgggaccagctggaccagctg
ggcatgcgcatgcagcacaacctggagcagcagatccaggccaggaacacaacaggtgtg
actgaggaggccctcaaagaattcagcatgatgtttaaacactttgacaaggacaagtct
ggcaggctgaaccatcaggagttcaaatcttgcctgcgctccctgggctatgacctgccc
atggtggaggaaggggaacctgaccctgagttcgaggcaatcctggacacggtggatccg
aacagagatggccatgtctccttgcaagaatacatggctttcatgatcagccgcgaaact
gagaacgtcaagtccagcgaggagattgagagcgccttccgggccctcagctcagaggga
aagccttacgtgaccaaggaggagctctaccagaacctgacccgggaacaagccgactac
tgcgtctcccacatgaagccctacgtggacggcaagggccgcgagctccccaccgcgttc
gactacgtggagttcacccgctcgcttttcgtgaactga

DBGET integrated database retrieval system