KEGG   Homo sapiens (human): 6714Help
Entry
6714              CDS       T01001                                 

Gene name
SRC, ASV, SRC1, c-SRC, p60-Src
Definition
v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (EC:2.7.10.2)
Orthology
K05704  
tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
VEGF signaling pathway
Focal adhesion
Adherens junction
Tight junction
Gap junction
Platelet activation
GABAergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Bacterial invasion of epithelial cells
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Tuberculosis
Hepatitis B
Viral carcinogenesis
Proteoglycans in cancer
Drug target
Dasatinib: 
Bosutinib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    6714 (SRC)
   04012 ErbB signaling pathway
    6714 (SRC)
   04370 VEGF signaling pathway
    6714 (SRC)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    6714 (SRC)
  Cell motility
   04810 Regulation of actin cytoskeleton
    6714 (SRC)
  Cell communication
   04510 Focal adhesion
    6714 (SRC)
   04520 Adherens junction
    6714 (SRC)
   04530 Tight junction
    6714 (SRC)
   04540 Gap junction
    6714 (SRC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    6714 (SRC)
   04062 Chemokine signaling pathway
    6714 (SRC)
  Endocrine system
   04912 GnRH signaling pathway
    6714 (SRC)
   04915 Estrogen signaling pathway
    6714 (SRC)
   04917 Prolactin signaling pathway
    6714 (SRC)
   04921 Oxytocin signaling pathway
    6714 (SRC)
   04919 Thyroid hormone signaling pathway
    6714 (SRC)
  Nervous system
   04727 GABAergic synapse
    6714 (SRC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6714 (SRC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6714 (SRC)
   05203 Viral carcinogenesis
    6714 (SRC)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6714 (SRC)
   05131 Shigellosis
    6714 (SRC)
   05152 Tuberculosis
    6714 (SRC)
   05100 Bacterial invasion of epithelial cells
    6714 (SRC)
   05161 Hepatitis B
    6714 (SRC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     6714 (SRC)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Src family
   6714 (SRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q12-q13
AA seq 536 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgtgcacggcgctggcgggggcgctttccccgcctcgcagacccccagcaag
ccagcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcacaggacagacaggctacatccccagcaactacgtg
gcgccctccgactccatccaggctgaggagtggtattttggcaagatcaccagacgggag
tcagagcggttactgctcaatgcagagaacccgagagggaccttcctcgtgcgagaaagt
gagaccacgaaaggtgcctactgcctctcagtgtctgacttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgc
acccagttcaacagcctgcagcagctggtggcctactactccaaacacgccgatggcctg
tgccaccgcctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggccaag
gatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggctgc
tttggcgaggtgtggatggggacctggaacggtaccaccagggtggccatcaaaaccctg
aagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctg
aggcatgagaagctggtgcagttgtatgctgtggtttcagaggagcccatttacatcgtc
acggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcgtacgtg
gagcggatgaactacgtccaccgggaccttcgtgcagccaacatcctggtgggagagaac
ctggtgtgcaaagtggccgactttgggctggctcggctcattgaagacaatgagtacacg
gcgcggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctatggc
cgcttcaccatcaagtcggacgtgtggtccttcgggatcctgctgactgagctcaccaca
aagggacgggtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgccggagtgtcccgagtccctgcacgacctcatgtgccag
tgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggggagaacctctag

DBGET integrated database retrieval system