KEGG   Homo sapiens (human): 6720Help
Entry
6720              CDS       T01001                                 

Gene name
SREBF1, SREBP-1c, SREBP1, SREBP1a, bHLHd1
Definition
(RefSeq) sterol regulatory element binding transcription factor 1
  KO
K07197  
sterol regulatory element-binding transcription factor 1
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Insulin signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    6720 (SREBF1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    6720 (SREBF1)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6720 (SREBF1)
   04931 Insulin resistance
    6720 (SREBF1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    6720 (SREBF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 1147 aa AA seqDB search
MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTD
PASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGP
GIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGN
TQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLL
QPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDA
EKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKS
AVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE
VEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR
GMLDRSRLALCTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGW
AQWLLPPVVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQ
AAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRV
DASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSALNLAECAGDAVSVATLAEIYV
AAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDWSVL
STPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYL
QLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
VEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTP
ASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSS
LRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGKGGAVAELEPR
PTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMRLGG
GTTVTSS
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggacgagccacccttcagcgaggcggctttggagcaggcgctgggcgagccgtgcgat
ctggacgcggcgctgctgaccgacatcgaagacatgcttcagcttatcaacaaccaagac
agtgacttccctggcctatttgacccaccctatgctgggagtggggcagggggcacagac
cctgccagccccgataccagctccccaggcagcttgtctccacctcctgccacattgagc
tcctctcttgaagccttcctgagcgggccgcaggcagcgccctcacccctgtcccctccc
cagcctgcacccactccattgaagatgtacccgtccatgcccgctttctcccctgggcct
ggtatcaaggaagagtcagtgccactgagcatcctgcagacccccaccccacagcccctg
ccaggggccctcctgccacagagcttcccagccccagccccaccgcagttcagctccacc
cctgtgttaggctaccccagccctccgggaggcttctctacaggaagccctcccgggaac
acccagcagccgctgcctggcctgccactggcttccccgccaggggtcccgcccgtctcc
ttgcacacccaggtccagagtgtggtcccccagcagctactgacagtcacagctgccccc
acggcagcccctgtaacgaccactgtgacctcgcagatccagcaggtcccggtcctgctg
cagccccacttcatcaaggcagactcgctgcttctgacagccatgaagacagacggagcc
actgtgaaggcggcaggtctcagtcccctggtctctggcaccactgtgcagacagggcct
ttgccgaccctggtgagtggcggaaccatcttggcaacagtcccactggtcgtagatgcg
gagaagctgcctatcaaccggctcgcagctggcagcaaggccccggcctctgcccagagc
cgtggagagaagcgcacagcccacaacgccattgagaagcgctaccgctcctccatcaat
gacaaaatcattgagctcaaggatctggtggtgggcactgaggcaaagctgaataaatct
gctgtcttgcgcaaggccatcgactacattcgctttctgcaacacagcaaccagaaactc
aagcaggagaacctaagtctgcgcactgctgtccacaaaagcaaatctctgaaggatctg
gtgtcggcctgtggcagtggagggaacacagacgtgctcatggagggcgtgaagactgag
gtggaggacacactgaccccacccccctcggatgctggctcacctttccagagcagcccc
ttgtcccttggcagcaggggcagtggcagcggtggcagtggcagtgactcggagcctgac
agcccagtctttgaggacagcaaggcaaagccagagcagcggccgtctctgcacagccgg
ggcatgctggaccgctcccgcctggccctgtgcacgctcgtcttcctctgcctgtcctgc
aaccccttggcctccttgctgggggcccgggggcttcccagcccctcagataccaccagc
gtctaccatagccctgggcgcaacgtgctgggcaccgagagcagagatggccctggctgg
gcccagtggctgctgcccccagtggtctggctgctcaatgggctgttggtgctcgtctcc
ttggtgcttctctttgtctacggtgagccagtcacacggccccactcaggccccgccgtg
tacttctggaggcatcgcaagcaggctgacctggacctggcccggggagactttgcccag
gctgcccagcagctgtggctggccctgcgggcactgggccggcccctgcccacctcccac
ctggacctggcttgtagcctcctctggaacctcatccgtcacctgctgcagcgtctctgg
gtgggccgctggctggcaggccgggcagggggcctgcagcaggactgtgctctgcgagtg
gatgctagcgccagcgcccgagacgcagccctggtctaccataagctgcaccagctgcac
accatggggaagcacacaggcgggcacctcactgccaccaacctggcgctgagtgccctg
aacctggcagagtgtgcaggggatgccgtgtctgtggcgacgctggccgagatctatgtg
gcggctgcattgagagtgaagaccagtctcccacgggccttgcattttctgacacgcttc
ttcctgagcagtgcccgccaggcctgcctggcacagagtggctcagtgcctcctgccatg
cagtggctctgccaccccgtgggccaccgtttcttcgtggatggggactggtccgtgctc
agtaccccatgggagagcctgtacagcttggccgggaacccagtggaccccctggcccag
gtgactcagctattccgggaacatctcttagagcgagcactgaactgtgtgacccagccc
aaccccagccctgggtcagctgatggggacaaggaattctcggatgccctcgggtacctg
cagctgctgaacagctgttctgatgctgcgggggctcctgcctacagcttctccatcagt
tccagcatggccaccaccaccggcgtagacccggtggccaagtggtgggcctctctgaca
gctgtggtgatccactggctgcggcgggatgaggaggcggctgagcggctgtgcccgctg
gtggagcacctgccccgggtgctgcaggagtctgagagacccctgcccagggcagctctg
cactccttcaaggctgcccgggccctgctgggctgtgccaaggcagagtctggtccagcc
agcctgaccatctgtgagaaggccagtgggtacctgcaggacagcctggctaccacacca
gccagcagctccattgacaaggccgtgcagctgttcctgtgtgacctgcttcttgtggtg
cgcaccagcctgtggcggcagcagcagcccccggccccggccccagcagcccagggcacc
agcagcaggccccaggcttccgcccttgagctgcgtggcttccaacgggacctgagcagc
ctgaggcggctggcacagagcttccggcccgccatgcggagggtgttcctacatgaggcc
acggcccggctgatggcgggggccagccccacacggacacaccagctcctcgaccgcagt
ctgaggcggcgggcaggccccggtggcaaaggaggcgcggtggcggagctggagccgcgg
cccacgcggcgggagcacgcggaggccttgctgctggcctcctgctacctgccccccggc
ttcctgtcggcgcccgggcagcgcgtgggcatgctggctgaggcggcgcgcacactcgag
aagcttggcgatcgccggctgctgcacgactgtcagcagatgctcatgcgcctgggcggt
gggaccactgtcacttccagctag

DBGET integrated database retrieval system