KEGG   Homo sapiens (human): 6720Help
Entry
6720              CDS       T01001                                 

Gene name
SREBF1, SREBP-1c, SREBP1, bHLHd1
Definition
sterol regulatory element binding transcription factor 1
Orthology
K07197  
sterol regulatory element-binding transcription factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Class
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 1177 aa AA seqDB search
MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFE
DMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGP
QAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFP
APAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVP
QQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPL
VSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNA
IEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA
VHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGS
GGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLALCTLVFLCLSCNPLASLLGAR
GLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVSLVLLFVYGEP
VTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWN
LIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHL
TATNLALSALNLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACL
AQSGSVPPAMQWLCHPVGHRFFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQLFREHLL
ERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVD
PVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQESERPLPRAALHSFKAARALL
GCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQLFLCDLLLVVRTSLWRQQQP
PAPAPAAQGTSSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASP
TRTHQLLDRSLRRRAGPGGKGGAVAELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVG
MLAEAARTLEKLGDRRLLHDCQQMLMRLGGGTTVTSS
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atggacgagccacccttcagcgaggcggctttggagcaggcgctgggcgagccgtgcgat
ctggacgcggcgctgctgaccgacatcgaaggtgaagtcggcgcggggaggggtagggcc
aacggcctggacgccccaagggcgggcgcagatcgcggagccatggattgcactttcgaa
gacatgcttcagcttatcaacaaccaagacagtgacttccctggcctatttgacccaccc
tatgctgggagtggggcagggggcacagaccctgccagccccgataccagctccccaggc
agcttgtctccacctcctgccacattgagctcctctcttgaagccttcctgagcgggccg
caggcagcgccctcacccctgtcccctccccagcctgcacccactccattgaagatgtac
ccgtccatgcccgctttctcccctgggcctggtatcaaggaagagtcagtgccactgagc
atcctgcagacccccaccccacagcccctgccaggggccctcctgccacagagcttccca
gccccagccccaccgcagttcagctccacccctgtgttaggctaccccagccctccggga
ggcttctctacaggaagccctcccgggaacacccagcagccgctgcctggcctgccactg
gcttccccgccaggggtcccgcccgtctccttgcacacccaggtccagagtgtggtcccc
cagcagctactgacagtcacagctgcccccacggcagcccctgtaacgaccactgtgacc
tcgcagatccagcaggtcccggtcctgctgcagccccacttcatcaaggcagactcgctg
cttctgacagccatgaagacagacggagccactgtgaaggcggcaggtctcagtcccctg
gtctctggcaccactgtgcagacagggcctttgccgaccctggtgagtggcggaaccatc
ttggcaacagtcccactggtcgtagatgcggagaagctgcctatcaaccggctcgcagct
ggcagcaaggccccggcctctgcccagagccgtggagagaagcgcacagcccacaacgcc
attgagaagcgctaccgctcctccatcaatgacaaaatcattgagctcaaggatctggtg
gtgggcactgaggcaaagctgaataaatctgctgtcttgcgcaaggccatcgactacatt
cgctttctgcaacacagcaaccagaaactcaagcaggagaacctaagtctgcgcactgct
gtccacaaaagcaaatctctgaaggatctggtgtcggcctgtggcagtggagggaacaca
gacgtgctcatggagggcgtgaagactgaggtggaggacacactgaccccacccccctcg
gatgctggctcacctttccagagcagccccttgtcccttggcagcaggggcagtggcagc
ggtggcagtggcagtgactcggagcctgacagcccagtctttgaggacagcaaggcaaag
ccagagcagcggccgtctctgcacagccggggcatgctggaccgctcccgcctggccctg
tgcacgctcgtcttcctctgcctgtcctgcaaccccttggcctccttgctgggggcccgg
gggcttcccagcccctcagataccaccagcgtctaccatagccctgggcgcaacgtgctg
ggcaccgagagcagagatggccctggctgggcccagtggctgctgcccccagtggtctgg
ctgctcaatgggctgttggtgctcgtctccttggtgcttctctttgtctacggtgagcca
gtcacacggccccactcaggccccgccgtgtacttctggaggcatcgcaagcaggctgac
ctggacctggcccggggagactttgcccaggctgcccagcagctgtggctggccctgcgg
gcactgggccggcccctgcccacctcccacctggacctggcttgtagcctcctctggaac
ctcatccgtcacctgctgcagcgtctctgggtgggccgctggctggcaggccgggcaggg
ggcctgcagcaggactgtgctctgcgagtggatgctagcgccagcgcccgagacgcagcc
ctggtctaccataagctgcaccagctgcacaccatggggaagcacacaggcgggcacctc
actgccaccaacctggcgctgagtgccctgaacctggcagagtgtgcaggggatgccgtg
tctgtggcgacgctggccgagatctatgtggcggctgcattgagagtgaagaccagtctc
ccacgggccttgcattttctgacacgcttcttcctgagcagtgcccgccaggcctgcctg
gcacagagtggctcagtgcctcctgccatgcagtggctctgccaccccgtgggccaccgt
ttcttcgtggatggggactggtccgtgctcagtaccccatgggagagcctgtacagcttg
gccgggaacccagtggaccccctggcccaggtgactcagctattccgggaacatctctta
gagcgagcactgaactgtgtgacccagcccaaccccagccctgggtcagctgatggggac
aaggaattctcggatgccctcgggtacctgcagctgctgaacagctgttctgatgctgcg
ggggctcctgcctacagcttctccatcagttccagcatggccaccaccaccggcgtagac
ccggtggccaagtggtgggcctctctgacagctgtggtgatccactggctgcggcgggat
gaggaggcggctgagcggctgtgcccgctggtggagcacctgccccgggtgctgcaggag
tctgagagacccctgcccagggcagctctgcactccttcaaggctgcccgggccctgctg
ggctgtgccaaggcagagtctggtccagccagcctgaccatctgtgagaaggccagtggg
tacctgcaggacagcctggctaccacaccagccagcagctccattgacaaggccgtgcag
ctgttcctgtgtgacctgcttcttgtggtgcgcaccagcctgtggcggcagcagcagccc
ccggccccggccccagcagcccagggcaccagcagcaggccccaggcttccgcccttgag
ctgcgtggcttccaacgggacctgagcagcctgaggcggctggcacagagcttccggccc
gccatgcggagggtgttcctacatgaggccacggcccggctgatggcgggggccagcccc
acacggacacaccagctcctcgaccgcagtctgaggcggcgggcaggccccggtggcaaa
ggaggcgcggtggcggagctggagccgcggcccacgcggcgggagcacgcggaggccttg
ctgctggcctcctgctacctgccccccggcttcctgtcggcgcccgggcagcgcgtgggc
atgctggctgaggcggcgcgcacactcgagaagcttggcgatcgccggctgctgcacgac
tgtcagcagatgctcatgcgcctgggcggtgggaccactgtcacttccagctag

DBGET integrated database retrieval system