KEGG   Homo sapiens (human): 6722Help
Entry
6722              CDS       T01001                                 

Gene name
SRF, MCM1
Definition
serum response factor (c-fos serum response element-binding transcription factor)
Orthology
K04378  
serum response factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 508 aa AA seqDB search
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgacccaagctggggccgcggcggctctgggccggggctcggccctggggggc
agcctgaaccggaccccgacggggcggccgggcggcggcggcgggacacgcggggctaac
gggggccgggtccccgggaatggcgcggggctcgggcccggccgcctggagcgggaggct
gcggcagcggcggcaaccaccccggcgcccaccgcgggggccctctacagcggcagcgag
ggcgactcggagtcgggcgaggaggaggagctgggcgccgagcggcgcggcctgaagcgg
agcctgagcgagatggagatcggtatggtggtcggtgggcccgaggcgtcggcagcggcc
accgggggctacgggccggtgagcggcgcggtgagcggggccaagccgggtaagaagacc
cggggccgcgtgaagatcaagatggagttcatcgacaacaagctgcggcgctacacgacc
ttcagcaagaggaagacgggcatcatgaagaaggcctatgagctgtccacgctgacaggg
acacaggtgctgttgctggtggccagtgagacaggccatgtgtatacctttgccacccga
aaactgcagcccatgatcaccagtgagaccggcaaggcactgattcagacctgcctcaac
tcgccagactctccaccccgttcagaccccacaacagaccagagaatgagtgccactggc
tttgaagagacagatctcacctaccaggtgtcggagtctgacagcagtggggagaccaag
gacacactgaagccggcgttcacagtcaccaacctgccgggtacaacctccaccatccaa
acagcacctagcacctctaccaccatgcaagtcagcagcggcccctcctttcccatcacc
aactacctggcaccagtgtctgctagtgtcagccccagtgctgtcagcagtgccaatggg
actgtgctgaagagtacaggcagcggccctgtctcctctgggggccttatgcagctgcct
accagcttcaccctcatgcctggtggggcagtggcccagcaggtcccagtgcaggccatt
caagtgcaccaggccccacagcaagcgtctccctcccgtgacagcagcacagacctcacg
cagacctcctccagcgggacagtgacgctgcccgccaccatcatgacgtcatccgtgccc
acaactgtgggtggccacatgatgtaccctagcccgcatgcggtgatgtatgcccccacc
tcgggcctgggtgatggcagcctcaccgtgctgaatgccttctcccaggcaccatccacc
atgcaggtgtcacacagccaggtccaggagccaggtggcgtcccccaggtgttcctgaca
gcatcatctgggacagtgcagatccctgtttcagcagttcagctccaccagatggctgtg
atagggcagcaggccgggagcagcagcaacctcaccgagctacaggtggtgaacctggac
accgcccacagcaccaagagtgaatga

DBGET integrated database retrieval system