KEGG   Homo sapiens (human): 6722Help
Entry
6722              CDS       T01001                                 

Gene name
SRF, MCM1
Definition
serum response factor (c-fos serum response element-binding transcription factor)
Orthology
K04378  
serum response factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
cGMP-PKG signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6722 (SRF)
   04022 cGMP - PKG signaling pathway
    6722 (SRF)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    6722 (SRF)
  Infectious diseases
   05166 HTLV-I infection
    6722 (SRF)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    6722 (SRF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 304 aa AA seqDB search
MITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLK
PAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLK
STGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSS
SGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVS
HSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHS
TKSE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccagtgagaccggcaaggcactgattcagacctgcctcaactcgccagactct
ccaccccgttcagaccccacaacagaccagagaatgagtgccactggctttgaagagaca
gatctcacctaccaggtgtcggagtctgacagcagtggggagaccaaggacacactgaag
ccggcgttcacagtcaccaacctgccgggtacaacctccaccatccaaacagcacctagc
acctctaccaccatgcaagtcagcagcggcccctcctttcccatcaccaactacctggca
ccagtgtctgctagtgtcagccccagtgctgtcagcagtgccaatgggactgtgctgaag
agtacaggcagcggccctgtctcctctgggggccttatgcagctgcctaccagcttcacc
ctcatgcctggtggggcagtggcccagcaggtcccagtgcaggccattcaagtgcaccag
gccccacagcaagcgtctccctcccgtgacagcagcacagacctcacgcagacctcctcc
agcgggacagtgacgctgcccgccaccatcatgacgtcatccgtgcccacaactgtgggt
ggccacatgatgtaccctagcccgcatgcggtgatgtatgcccccacctcgggcctgggt
gatggcagcctcaccgtgctgaatgccttctcccaggcaccatccaccatgcaggtgtca
cacagccaggtccaggagccaggtggcgtcccccaggtgttcctgacagcatcatctggg
acagtgcagatccctgtttcagcagttcagctccaccagatggctgtgatagggcagcag
gccgggagcagcagcaacctcaccgagctacaggtggtgaacctggacaccgcccacagc
accaagagtgaatga

DBGET integrated database retrieval system