KEGG   Homo sapiens (human): 6741Help
Entry
6741              CDS       T01001                                 

Gene name
SSB, LARP3, La, La/SSB
Definition
Sjogren syndrome antigen B (autoantigen La)
Orthology
K11090  
lupus La protein
Organism
hsa  Homo sapiens (human)
Pathway
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    6741 (SSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31.1
AA seq 408 aa AA seqDB search
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNR
LTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPT
DATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDL
LILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDL
DDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKE
VTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGSGKGKVQFQGK
KTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatggtgataatgaaaagatggctgccctggaggccaaaatctgtcatcaa
attgagtattattttggcgacttcaatttgccacgggacaagtttctaaaggaacagata
aaactggatgaaggctgggtacctttggagataatgataaaattcaacaggttgaaccgt
ctaacaacagactttaatgtaattgtggaagcattgagcaaatccaaggcagaactcatg
gaaatcagtgaagataaaactaaaatcagaaggtctccaagcaaacccctacctgaagtg
actgatgagtataaaaatgatgtaaaaaacagatctgtttatattaaaggcttcccaact
gatgcaactcttgatgacataaaagaatggttagaagataaaggtcaagtactaaatatt
cagatgagaagaacattgcataaagcatttaagggatcaatttttgttgtgtttgatagc
attgaatctgctaagaaatttgtagagacccctggccagaagtacaaagaaacagacctg
ctaatacttttcaaggacgattactttgccaaaaaaaatgaagaaagaaaacaaaataaa
gtggaagctaaattaagagctaaacaggagcaagaagcaaaacaaaagttagaagaagat
gctgaaatgaaatctctagaagaaaagattggatgcttgctgaaattttcgggtgattta
gatgatcagacctgtagagaagatttacacatacttttctcaaatcatggtgaaataaaa
tggatagacttcgtcagaggagcaaaagaggggataattctatttaaagaaaaagccaag
gaagcattgggtaaagccaaagatgcaaataatggtaacctacaattaaggaacaaagaa
gtgacttgggaagtactagaaggagaggtggaaaaagaagcactgaagaaaataatagaa
gaccaacaagaatccctaaacaaatggaagtcaaaaggtcgtagatttaaaggaaaagga
aagggtaataaagctgcccagcctgggtctggtaaaggaaaagtacagtttcagggcaag
aaaacgaaatttgctagtgatgatgaacatgatgaacatgatgaaaatggtgcaactgga
cctgtgaaaagagcaagagaagaaacagacaaagaagaacctgcatccaaacaacagaaa
acagaaaatggtgctggagaccagtag

DBGET integrated database retrieval system