KEGG   Homo sapiens (human): 6750Help
Entry
6750              CDS       T01001                                 

Gene name
SST, SMST
Definition
somatostatin
Orthology
K05237  
somatostatin
Organism
hsa  Homo sapiens (human)
Pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6750 (SST)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    6750 (SST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q28
AA seq 116 aa AA seqDB search
MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctgccgcctccagtgcgcgctggctgcgctgtccatcgtcctggccctgggc
tgtgtcaccggcgctccctcggaccccagactccgtcagtttctgcagaagtccctggct
gctgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc
aaccagacggagaatgatgccctggaacctgaagatctgtcccaggctgctgagcaggat
gaaatgaggcttgagctgcagagatctgctaactcaaacccggctatggcaccccgagaa
cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system