KEGG   Homo sapiens (human): 6772Help
Entry
6772              CDS       T01001                                 

Gene name
STAT1, CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91
Definition
signal transducer and activator of transcription 1, 91kDa
Orthology
K11220  
signal transducer and activator of transcription 1
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Leishmaniasis
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Pathways in cancer
Pancreatic cancer
Inflammatory bowel disease (IBD)
Module
JAK-STAT signaling
Disease
H00089  
IFN-gamma/IL-12 axis
H00363  
Candidiasis
H01109  
Chronic mucocutaneous candidiasis (CMC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    6772 (STAT1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    6772 (STAT1)
   04062 Chemokine signaling pathway
    6772 (STAT1)
  Endocrine system
   04917 Prolactin signaling pathway
    6772 (STAT1)
   04919 Thyroid hormone signaling pathway
    6772 (STAT1)
  Development
   04380 Osteoclast differentiation
    6772 (STAT1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6772 (STAT1)
   05212 Pancreatic cancer
    6772 (STAT1)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    6772 (STAT1)
  Infectious diseases
   05152 Tuberculosis
    6772 (STAT1)
   05162 Measles
    6772 (STAT1)
   05164 Influenza A
    6772 (STAT1)
   05161 Hepatitis B
    6772 (STAT1)
   05160 Hepatitis C
    6772 (STAT1)
   05168 Herpes simplex infection
    6772 (STAT1)
   05145 Toxoplasmosis
    6772 (STAT1)
   05140 Leishmaniasis
    6772 (STAT1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6772 (STAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q32.2
AA seq 750 aa AA seqDB search
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggtacgaacttcagcagcttgactcaaaattcctggagcaggttcaccag
ctttatgatgacagttttcccatggaaatcagacagtacctggcacagtggttagaaaag
caagactgggagcacgctgccaatgatgtttcatttgccaccatccgttttcatgacctc
ctgtcacagctggatgatcaatatagtcgcttttctttggagaataacttcttgctacag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatccag
atgtctatgatcatttacagctgtctgaaggaagaaaggaaaattctggaaaacgcccag
agatttaatcaggctcagtcggggaatattcagagcacagtgatgttagacaaacagaaa
gagcttgacagtaaagtcagaaatgtgaaggacaaggttatgtgtatagagcatgaaatc
aagagcctggaagatttacaagatgaatatgacttcaaatgcaaaaccttgcagaacaga
gaacacgagaccaatggtgtggcaaagagtgatcagaaacaagaacagctgttactcaag
aagatgtatttaatgcttgacaataagagaaaggaagtagttcacaaaataatagagttg
ctgaatgtcactgaacttacccagaatgccctgattaatgatgaactagtggagtggaag
cggagacagcagagcgcctgtattggggggccgcccaatgcttgcttggatcagctgcag
aactggttcactatagttgcggagagtctgcagcaagttcggcagcagcttaaaaagttg
gaggaattggaacagaaatacacctacgaacatgaccctatcacaaaaaacaaacaagtg
ttatgggaccgcaccttcagtcttttccagcagctcattcagagctcgtttgtggtggaa
agacagccctgcatgccaacgcaccctcagaggccgctggtcttgaagacaggggtccag
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttaggaagttc
aacattttgggcacgcacacaaaagtgatgaacatggaggagtccaccaatggcagtctg
gcggctgaatttcggcacctgcaattgaaagaacagaaaaatgctggcaccagaacgaat
gagggtcctctcatcgttactgaagagcttcactcccttagttttgaaacccaattgtgc
cagcctggtttggtaattgacctcgagacgacctctctgcccgttgtggtgatctccaac
gtcagccagctcccgagcggttgggcctccatcctttggtacaacatgctggtggcggaa
cccaggaatctgtccttcttcctgactccaccatgtgcacgatgggctcagctttcagaa
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgttgggagagaagcttcttggtcctaacgccagccccgatggtctcattccgtggacg
aggttttgtaaggaaaatataaatgataaaaattttcccttctggctttggattgaaagc
atcctagaactcattaaaaaacacctgctccctctctggaatgatgggtgcatcatgggc
ttcatcagcaaggagcgagagcgtgccctgttgaaggaccagcagccggggaccttcctg
ctgcggttcagtgagagctcccgggaaggggccatcacattcacatgggtggagcggtcc
cagaacggaggcgaacctgacttccatgcggttgaaccctacacgaagaaagaactttct
gctgttactttccctgacatcattcgcaattacaaagtcatggctgctgagaatattcct
gagaatcccctgaagtatctgtatccaaatattgacaaagaccatgcctttggaaagtat
tactccaggccaaaggaagcaccagagccaatggaacttgatggccctaaaggaactgga
tatatcaagactgagttgatttctgtgtctgaagttcacccttctagacttcagaccaca
gacaacctgctccccatgtctcctgaggagtttgacgaggtgtctcggatagtgggctct
gtagaattcgacagtatgatgaacacagtatag

DBGET integrated database retrieval system