KEGG   Homo sapiens (human): 6773Help
Entry
6773              CDS       T01001                                 

Gene name
STAT2, IMD44, ISGF-3, P113, STAT113
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
Module
hsa_M00684  JAK-STAT signaling
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to host-cell-protein inhibition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    6773 (STAT2)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    6773 (STAT2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    6773 (STAT2)
   04625 C-type lectin receptor signaling pathway
    6773 (STAT2)
   04062 Chemokine signaling pathway
    6773 (STAT2)
  Development
   04380 Osteoclast differentiation
    6773 (STAT2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6773 (STAT2)
  Infectious diseases
   05162 Measles
    6773 (STAT2)
   05164 Influenza A
    6773 (STAT2)
   05161 Hepatitis B
    6773 (STAT2)
   05160 Hepatitis C
    6773 (STAT2)
   05168 Herpes simplex infection
    6773 (STAT2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    6773 (STAT2)
   05165 Human papillomavirus infection
    6773 (STAT2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6773 (STAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT2_C STAT_int SH2 CorA
Motif
Other DBs
NCBI-GeneID: 6773
NCBI-ProteinID: NP_005410
OMIM: 600556
HGNC: 11363
Ensembl: ENSG00000170581
Vega: OTTHUMG00000170760
Pharos: P52630(Tbio)
UniProt: P52630 R9QE65
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 851 aa AA seqDB search
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELES
LELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF
YTDGPLMPSDF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtgggaaatgctgcagaatcttgacagcccctttcaggatcagctgcaccag
ctttactcgcacagcctcctgcctgtggacattcgacagtacttggctgtctggattgaa
gaccagaactggcaggaagctgcacttgggagtgatgattccaaggctaccatgctattc
ttccacttcttggatcagctgaactatgagtgtggccgttgcagccaggacccagagtcc
ttgttgctgcagcacaatttgcggaaattctgccgggacattcagcccttttcccaggat
cctacccagttggctgagatgatctttaacctccttctggaagaaaaaagaattttgatc
caggctcagagggcccaattggaacaaggagagccagttctcgaaacacctgtggagagc
cagcaacatgagattgaatcccggatcctggatttaagggctatgatggagaagctggta
aaatccatcagccaactgaaagaccagcaggatgtcttctgcttccgatataagatccag
gccaaagggaagacaccctctctggacccccatcagaccaaagagcagaagattctgcag
gaaactctcaatgaactggacaaaaggagaaaggaggtgctggatgcctccaaagcactg
ctaggccgattaactaccctaatcgagctactgctgccaaagttggaggagtggaaggcc
cagcagcaaaaagcctgcatcagagctcccattgaccacgggttggaacagctggagaca
tggttcacagctggagcaaagctgttgtttcacctgaggcagctgctgaaggagctgaag
ggactgagttgcctggttagctatcaggatgaccctctgaccaaaggggtggacctacgc
aacgcccaggtcacagagttgctacagcgtctgctccacagagcctttgtggtagaaacc
cagccctgcatgccccaaactccccatcgacccctcatcctcaagactggcagcaagttc
accgtccgaacaaggctgctggtgagactccaggaaggcaatgagtcactgactgtggaa
gtctccattgacaggaatcctcctcaattacaaggcttccggaagttcaacattctgact
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggtttgatttgggacttt
ggttacctgactctggtggagcaacgttcaggtggttcaggaaagggcagcaataagggg
ccactaggtgtgacagaggaactgcacatcatcagcttcacggtcaaatatacctaccag
ggtctgaagcaggagctgaaaacggacaccctccctgtggtgattatttccaacatgaac
cagctctcaattgcctgggcttcagttctctggttcaatttgctcagcccaaaccttcag
aaccagcagttcttctccaacccccccaaggccccctggagcttgctgggccctgctctc
agttggcagttctcctcctatgttggccgaggcctcaactcagaccagctgagcatgctg
agaaacaagctgttcgggcagaactgtaggactgaggatccattattgtcctgggctgac
ttcactaagcgagagagccctcctggcaagttaccattctggacatggctggacaaaatt
ctggagttggtacatgaccacctgaaggatctctggaatgatggacgcatcatgggcttt
gtgagtcggagccaggagcgccggctgctgaagaagaccatgtctggcacctttctactg
cgcttcagtgaatcgtcagaagggggcattacctgctcctgggtggagcaccaggatgat
gacaaggtgctcatctactctgtgcaaccgtacacgaaggaggtgctgcagtcactcccg
ctgactgaaatcatccgccattaccagttgctcactgaggagaatatacctgaaaaccca
ctgcgcttcctctatccccgaatcccccgggatgaagcttttgggtgctactaccaggag
aaagttaatctccaggaacggaggaaatacctgaaacacaggctcattgtggtctctaat
agacaggtggatgaactgcaacaaccgctggagcttaagccagagccagagctggagtca
ttagagctggaactagggctggtgccagagccagagctcagcctggacttagagccactg
ctgaaggcagggctggatctggggccagagctagagtctgtgctggagtccactctggag
cctgtgatagagcccacactatgcatggtatcacaaacagtgccagagccagaccaagga
cctgtatcacagccagtgccagagccagatttgccctgtgatctgagacatttgaacact
gagccaatggaaatcttcagaaactgtgtaaagattgaagaaatcatgccgaatggtgac
ccactgttggctggccagaacaccgtggatgaggtttacgtctcccgccccagccacttc
tacactgatggacccttgatgccttctgacttctag

DBGET integrated database retrieval system