KEGG   Homo sapiens (human): 6773Help
Entry
6773              CDS       T01001                                 

Gene name
STAT2, IMD44, ISGF-3, P113, STAT113
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  
signal transducer and activator of transcription 2
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Osteoclast differentiation
NOD-like receptor signaling pathway
Jak-STAT signaling pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Module
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    6773 (STAT2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    6773 (STAT2)
   04062 Chemokine signaling pathway
    6773 (STAT2)
  Development
   04380 Osteoclast differentiation
    6773 (STAT2)
 Human Diseases
  Infectious diseases
   05162 Measles
    6773 (STAT2)
   05164 Influenza A
    6773 (STAT2)
   05161 Hepatitis B
    6773 (STAT2)
   05160 Hepatitis C
    6773 (STAT2)
   05168 Herpes simplex infection
    6773 (STAT2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6773 (STAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P52630(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 851 aa AA seqDB search
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELES
LELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF
YTDGPLMPSDF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtgggaaatgctgcagaatcttgacagcccctttcaggatcagctgcaccag
ctttactcgcacagcctcctgcctgtggacattcgacagtacttggctgtctggattgaa
gaccagaactggcaggaagctgcacttgggagtgatgattccaaggctaccatgctattc
ttccacttcttggatcagctgaactatgagtgtggccgttgcagccaggacccagagtcc
ttgttgctgcagcacaatttgcggaaattctgccgggacattcagcccttttcccaggat
cctacccagttggctgagatgatctttaacctccttctggaagaaaaaagaattttgatc
caggctcagagggcccaattggaacaaggagagccagttctcgaaacacctgtggagagc
cagcaacatgagattgaatcccggatcctggatttaagggctatgatggagaagctggta
aaatccatcagccaactgaaagaccagcaggatgtcttctgcttccgatataagatccag
gccaaagggaagacaccctctctggacccccatcagaccaaagagcagaagattctgcag
gaaactctcaatgaactggacaaaaggagaaaggaggtgctggatgcctccaaagcactg
ctaggccgattaactaccctaatcgagctactgctgccaaagttggaggagtggaaggcc
cagcagcaaaaagcctgcatcagagctcccattgaccacgggttggaacagctggagaca
tggttcacagctggagcaaagctgttgtttcacctgaggcagctgctgaaggagctgaag
ggactgagttgcctggttagctatcaggatgaccctctgaccaaaggggtggacctacgc
aacgcccaggtcacagagttgctacagcgtctgctccacagagcctttgtggtagaaacc
cagccctgcatgccccaaactccccatcgacccctcatcctcaagactggcagcaagttc
accgtccgaacaaggctgctggtgagactccaggaaggcaatgagtcactgactgtggaa
gtctccattgacaggaatcctcctcaattacaaggcttccggaagttcaacattctgact
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggtttgatttgggacttt
ggttacctgactctggtggagcaacgttcaggtggttcaggaaagggcagcaataagggg
ccactaggtgtgacagaggaactgcacatcatcagcttcacggtcaaatatacctaccag
ggtctgaagcaggagctgaaaacggacaccctccctgtggtgattatttccaacatgaac
cagctctcaattgcctgggcttcagttctctggttcaatttgctcagcccaaaccttcag
aaccagcagttcttctccaacccccccaaggccccctggagcttgctgggccctgctctc
agttggcagttctcctcctatgttggccgaggcctcaactcagaccagctgagcatgctg
agaaacaagctgttcgggcagaactgtaggactgaggatccattattgtcctgggctgac
ttcactaagcgagagagccctcctggcaagttaccattctggacatggctggacaaaatt
ctggagttggtacatgaccacctgaaggatctctggaatgatggacgcatcatgggcttt
gtgagtcggagccaggagcgccggctgctgaagaagaccatgtctggcacctttctactg
cgcttcagtgaatcgtcagaagggggcattacctgctcctgggtggagcaccaggatgat
gacaaggtgctcatctactctgtgcaaccgtacacgaaggaggtgctgcagtcactcccg
ctgactgaaatcatccgccattaccagttgctcactgaggagaatatacctgaaaaccca
ctgcgcttcctctatccccgaatcccccgggatgaagcttttgggtgctactaccaggag
aaagttaatctccaggaacggaggaaatacctgaaacacaggctcattgtggtctctaat
agacaggtggatgaactgcaacaaccgctggagcttaagccagagccagagctggagtca
ttagagctggaactagggctggtgccagagccagagctcagcctggacttagagccactg
ctgaaggcagggctggatctggggccagagctagagtctgtgctggagtccactctggag
cctgtgatagagcccacactatgcatggtatcacaaacagtgccagagccagaccaagga
cctgtatcacagccagtgccagagccagatttgccctgtgatctgagacatttgaacact
gagccaatggaaatcttcagaaactgtgtaaagattgaagaaatcatgccgaatggtgac
ccactgttggctggccagaacaccgtggatgaggtttacgtctcccgccccagccacttc
tacactgatggacccttgatgccttctgacttctag

DBGET integrated database retrieval system