KEGG   Homo sapiens (human): 6776Help
Entry
6776              CDS       T01001                                 

Gene name
STAT5A, MGF, STAT5
Definition
signal transducer and activator of transcription 5A
Orthology
K11223  
signal transducer and activator of transcription 5A
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    6776 (STAT5A)
   04630 Jak-STAT signaling pathway
    6776 (STAT5A)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    6776 (STAT5A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6776 (STAT5A)
   05203 Viral carcinogenesis
    6776 (STAT5A)
   05221 Acute myeloid leukemia
    6776 (STAT5A)
   05220 Chronic myeloid leukemia
    6776 (STAT5A)
  Infectious diseases
   05166 HTLV-I infection
    6776 (STAT5A)
   05162 Measles
    6776 (STAT5A)
   05161 Hepatitis B
    6776 (STAT5A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6776 (STAT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 794 aa AA seqDB search
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATY
MDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagacgcgctgcgccagatgcaggtg
ctgtacggccagcacttccccatcgaggtccggcactacttggcccagtggattgagagc
cagccatgggatgccattgacttggacaatccccaggacagagcccaagccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactacgccacgcagctccagaaaacatatgaccgc
tgccccctggagctggtccgctgcatccggcacattctgtacaatgaacagaggctggtc
cgagaagccaacaattgcagctctccggctgggatcctggttgacgccatgtcccagaag
caccttcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacagagaat
gagctgaagaaactgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttgcccagctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacattatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccaccgtacgcctgctggtgggcgggaagctg
aacgtgcacatgaatcccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgcttaaaaatgagaacacccgcaacgagtgcagtggtgagatcctgaacaactgc
tgcgtgatggagtaccaccaagccacgggcaccctcagtgcccacttcaggaacatgtca
ctgaagaggatcaagcgtgctgaccggcggggtgcagagtccgtgacagaggagaagttc
acagtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgttccaggtgaag
actctgtccctacctgtggttgtcatcgtccacggcagccaggaccacaatgccacggct
actgtgctgtgggacaatgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcagtggtttgacggggtgatggaggtg
ttgaagaagcaccacaagccccactggaatgatggggccatcctaggttttgtgaataag
caacaggcccacgacctgctcatcaacaagcccgacgggaccttcttgttgcgctttagt
gactcagaaatcgggggcatcaccatcgcctggaagtttgactccccggaacgcaacctg
tggaacctgaaaccattcaccacgcgggatttctccatcaggtccctggctgaccggctg
ggggacctgagctatctcatctatgtgtttcctgaccgccccaaggatgaggtcttctcc
aagtactacactcctgtgctggctaaagctgttgatggatatgtgaaaccacagatcaag
caagtggtccctgagtttgtgaatgcatctgcagatgctgggggcagcagcgccacgtac
atggaccaggccccctccccagctgtgtgcccccaggctccctataacatgtacccacag
aaccctgaccatgtactcgatcaggatggagaattcgacctggatgagaccatggatgtg
gccaggcacgtggaggaactcttacgccgaccaatggacagtcttgactcccgcctctcg
ccccctgccggtcttttcacctctgccagaggctccctctcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system