KEGG   Homo sapiens (human): 6778Help
Entry
6778              CDS       T01001                                 

Gene name
STAT6, D12S1644, IL-4-STAT, STAT6B, STAT6C
Definition
signal transducer and activator of transcription 6, interleukin-4 induced
Orthology
K11225  
signal transducer and activator of transcription 6
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Hepatitis B
Inflammatory bowel disease (IBD)
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 847 aa AA seqDB search
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
LRANPSW
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaagatgcccccagaaaaagtgcagcggctctatgtc
gactttccccaacacctgcggcatcttctgggtgactggctggagagccagccctgggag
ttcctggtcggctccgacgccttctgctgcaacttggctagtgccctactttcagacact
gtccagcaccttcaggcctcggtgggagagcagggggaggggagcaccatcttgcaacac
atcagcacccttgagagcatatatcagagggaccccctgaagctggtggccactttcaga
caaatacttcaaggagagaaaaaagctgttatggaacagttccgccacttgccaatgcct
ttccactggaagcaggaagaactcaagtttaagacaggcttgcggaggctgcagcaccga
gtaggggagatccaccttctccgagaagccctgcagaagggggctgaggctggccaagtg
tctctgcacagcttgatagaaactcctgctaatgggactgggccaagtgaggccctggcc
atgctactgcaggagaccactggagagctagaggcagccaaagccctagtgctgaagagg
atccagatttggaaacggcagcagcagctggcagggaatggcgcaccgtttgaggagagc
ctggccccactccaggagaggtgtgaaagcctggtggacatttattcccagctacagcag
gaggtaggggcggctggtggggagcttgagcccaagacccgggcatcgctgactggccgg
ctggatgaagtcctgagaaccctcgtcaccagttgcttcctggtggagaagcagcccccc
caggtactgaagactcagaccaagttccaggctggagttcgattcctgttgggcttgagg
ttcctgggggccccagccaagcctccgctggtcagggccgacatggtgacagagaagcag
gcgcgggagctgagtgtgcctcagggtcctggggctggagcagaaagcactggagaaatc
atcaacaacactgtgcccttggagaacagcattcctgggaactgctgctctgccctgttc
aagaacctgcttctcaagaagatcaagcggtgtgagcggaagggcactgagtctgtcaca
gaggagaagtgcgctgtgctcttctctgccagcttcacacttggccccggcaaactcccc
atccagctccaggccctgtctctgcccctggtggtcatcgtccatggcaaccaagacaac
aatgccaaagccactatcctgtgggacaatgccttctctgagatggaccgcgtgcccttt
gtggtggctgagcgggtgccctgggagaagatgtgtgaaactctgaacctgaagttcatg
gctgaggtggggaccaaccgggggctgctcccagagcacttcctcttcctggcccagaag
atcttcaatgacaacagcctcagtatggaggccttccagcaccgttctgtgtcctggtcg
cagttcaacaaggagatcctgctgggccgtggcttcaccttttggcagtggtttgatggt
gtcctggacctcaccaaacgctgtctccggagctactggtctgaccggctgatcattggc
ttcatcagcaaacagtacgttactagccttcttctcaatgagcccgacggaacctttctc
ctccgcttcagcgactcagagattgggggcatcaccattgcccatgtcatccggggccag
gatggctctccacagatagagaacatccagccattctctgccaaagacctgtccattcgc
tcactgggggaccgaatccgggatcttgctcagctcaaaaatctctatcccaagaagccc
aaggatgaggctttccggagccactacaagcctgaacagatgggtaaggatggcaggggt
tatgtcccagctaccatcaagatgaccgtggaaagggaccaaccacttcctaccccagag
ctccagatgcctaccatggtgccttcttatgaccttggaatggcccctgattcctccatg
agcatgcagcttggcccagatatggtgccccaggtgtacccaccacactctcactccatc
cccccgtatcaaggcctctccccagaagaatcagtcaacgtgttgtcagccttccaggag
cctcacctgcagatgccccccagcctgggccagatgagcctgccctttgaccagcctcac
ccccagggcctgctgccgtgccagcctcaggagcatgctgtgtccagccctgaccccctg
ctctgctcagatgtgaccatggtggaagacagctgcctgagccagccagtgacagcgttt
cctcagggcacttggattggtgaagacatattccctcctctgctgcctcccactgaacag
gacctcactaagcttctcctggaggggcaaggggagtcggggggagggtccttgggggca
cagcccctcctgcagccctcccactatgggcaatctgggatctcaatgtcccacatggac
ctaagggccaaccccagttggtga

DBGET integrated database retrieval system