KEGG   Homo sapiens (human): 6778Help
Entry
6778              CDS       T01001                                 

Gene name
STAT6, D12S1644, IL-4-STAT, STAT6B, STAT6C
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  
signal transducer and activator of transcription 6
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Th1 and Th2 cell differentiation
Hepatitis B
Inflammatory bowel disease (IBD)
Module
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    6778 (STAT6)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    6778 (STAT6)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    6778 (STAT6)
  Infectious diseases
   05161 Hepatitis B
    6778 (STAT6)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6778 (STAT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13
AA seq 847 aa AA seqDB search
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
LRANPSW
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaagatgcccccagaaaaagtgcagcggctctatgtc
gactttccccaacacctgcggcatcttctgggtgactggctggagagccagccctgggag
ttcctggtcggctccgacgccttctgctgcaacttggctagtgccctactttcagacact
gtccagcaccttcaggcctcggtgggagagcagggggaggggagcaccatcttgcaacac
atcagcacccttgagagcatatatcagagggaccccctgaagctggtggccactttcaga
caaatacttcaaggagagaaaaaagctgttatggaacagttccgccacttgccaatgcct
ttccactggaagcaggaagaactcaagtttaagacaggcttgcggaggctgcagcaccga
gtaggggagatccaccttctccgagaagccctgcagaagggggctgaggctggccaagtg
tctctgcacagcttgatagaaactcctgctaatgggactgggccaagtgaggccctggcc
atgctactgcaggagaccactggagagctagaggcagccaaagccctagtgctgaagagg
atccagatttggaaacggcagcagcagctggcagggaatggcgcaccgtttgaggagagc
ctggccccactccaggagaggtgtgaaagcctggtggacatttattcccagctacagcag
gaggtaggggcggctggtggggagcttgagcccaagacccgggcatcgctgactggccgg
ctggatgaagtcctgagaaccctcgtcaccagttgcttcctggtggagaagcagcccccc
caggtactgaagactcagaccaagttccaggctggagttcgattcctgttgggcttgagg
ttcctgggggccccagccaagcctccgctggtcagggccgacatggtgacagagaagcag
gcgcgggagctgagtgtgcctcagggtcctggggctggagcagaaagcactggagaaatc
atcaacaacactgtgcccttggagaacagcattcctgggaactgctgctctgccctgttc
aagaacctgcttctcaagaagatcaagcggtgtgagcggaagggcactgagtctgtcaca
gaggagaagtgcgctgtgctcttctctgccagcttcacacttggccccggcaaactcccc
atccagctccaggccctgtctctgcccctggtggtcatcgtccatggcaaccaagacaac
aatgccaaagccactatcctgtgggacaatgccttctctgagatggaccgcgtgcccttt
gtggtggctgagcgggtgccctgggagaagatgtgtgaaactctgaacctgaagttcatg
gctgaggtggggaccaaccgggggctgctcccagagcacttcctcttcctggcccagaag
atcttcaatgacaacagcctcagtatggaggccttccagcaccgttctgtgtcctggtcg
cagttcaacaaggagatcctgctgggccgtggcttcaccttttggcagtggtttgatggt
gtcctggacctcaccaaacgctgtctccggagctactggtctgaccggctgatcattggc
ttcatcagcaaacagtacgttactagccttcttctcaatgagcccgacggaacctttctc
ctccgcttcagcgactcagagattgggggcatcaccattgcccatgtcatccggggccag
gatggctctccacagatagagaacatccagccattctctgccaaagacctgtccattcgc
tcactgggggaccgaatccgggatcttgctcagctcaaaaatctctatcccaagaagccc
aaggatgaggctttccggagccactacaagcctgaacagatgggtaaggatggcaggggt
tatgtcccagctaccatcaagatgaccgtggaaagggaccaaccacttcctaccccagag
ctccagatgcctaccatggtgccttcttatgaccttggaatggcccctgattcctccatg
agcatgcagcttggcccagatatggtgccccaggtgtacccaccacactctcactccatc
cccccgtatcaaggcctctccccagaagaatcagtcaacgtgttgtcagccttccaggag
cctcacctgcagatgccccccagcctgggccagatgagcctgccctttgaccagcctcac
ccccagggcctgctgccgtgccagcctcaggagcatgctgtgtccagccctgaccccctg
ctctgctcagatgtgaccatggtggaagacagctgcctgagccagccagtgacagcgttt
cctcagggcacttggattggtgaagacatattccctcctctgctgcctcccactgaacag
gacctcactaagcttctcctggaggggcaaggggagtcggggggagggtccttgggggca
cagcccctcctgcagccctcccactatgggcaatctgggatctcaatgtcccacatggac
ctaagggccaaccccagttggtga

DBGET integrated database retrieval system