KEGG   Homo sapiens (human): 6789Help
Entry
6789              CDS       T01001                                 

Gene name
STK4, KRS2, MST1, TIIAC, YSK3
Definition
serine/threonine kinase 4 (EC:2.7.11.1)
Orthology
K04411  
serine/threonine kinase 4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
FoxO signaling pathway
Pathways in cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.2-q13.2
AA seq 487 aa AA seqDB search
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDV
KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtacagctgaggaacccgccgcgccggcagctgaaaaagttggatgaagat
agtttaaccaaacaaccagaagaagtatttgatgtcttagagaaacttggagaagggtcc
tatggcagcgtatacaaagctattcataaagagaccggccagattgttgctattaagcaa
gttcctgtggaatcagacctccaggagataatcaaagaaatctctataatgcagcaatgt
gacagccctcatgtagtcaaatattatggcagttattttaagaacacagacttatggatc
gttatggagtactgtggggctggttctgtatctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggacttgaatacctt
cattttatgagaaaaatacaccgagatatcaaggcaggaaatattttgctaaatacagaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagataccatggccaag
cggaatacagtgataggaacaccattttggatggctccagaagtgattcaggaaattgga
tacaactgtgtagcagacatctggtccctgggaataactgccatagaaatggctgaagga
aagcccccttatgctgatatccatccaatgagggcaatcttcatgattcctacaaatcct
cctcccacattccgaaaaccagagctatggtcagataactttacagattttgtgaaacag
tgtcttgtaaagagccctgagcagagggccacagccactcagctcctgcagcacccattt
gtcaggagtgccaaaggagtgtcaatactgcgagacttaattaatgaagccatggatgtg
aaactgaaacgccaggaatcccagcagcgggaagtggaccaggacgatgaagaaaactca
gaagaggatgaaatggattctggcacgatggttcgagcagtgggtgatgagatgggcact
gtccgagtagccagcaccatgactgatggagccaatactatgattgagcacgatgacacg
ttgccatcacaactgggcaccatggtgatcaatgcagaggatgaggaagaggaaggaact
atgaaaagaagggatgagaccatgcagcctgcgaaaccatcctttcttgaatattttgaa
caaaaagaaaaggaaaaccagatcaacagctttggcaagagtgtacctggtccactgaaa
aattcttcagattggaaaataccacaggatggagactacgagtttcttaagagttggaca
gtggaggaccttcagaagaggctcttggccctggaccccatgatggagcaggagattgaa
gagatccggcagaagtaccagtccaagcggcagcccatcctggatgccatagaggctaag
aagagacggcaacaaaacttctga

DBGET integrated database retrieval system