KEGG   Homo sapiens (human): 6789Help
Entry
6789              CDS       T01001                                 

Gene name
STK4, KRS2, MST1, TIIAC, YSK3
Definition
serine/threonine kinase 4 (EC:2.7.11.1)
Orthology
K04411  
serine/threonine kinase 4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
FoxO signaling pathway
Pathways in cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    6789 (STK4)
   04010 MAPK signaling pathway
    6789 (STK4)
   04068 FoxO signaling pathway
    6789 (STK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6789 (STK4)
   05223 Non-small cell lung cancer
    6789 (STK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   6789 (STK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.2-q13.2
AA seq 487 aa AA seqDB search
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDV
KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtacagctgaggaacccgccgcgccggcagctgaaaaagttggatgaagat
agtttaaccaaacaaccagaagaagtatttgatgtcttagagaaacttggagaagggtcc
tatggcagcgtatacaaagctattcataaagagaccggccagattgttgctattaagcaa
gttcctgtggaatcagacctccaggagataatcaaagaaatctctataatgcagcaatgt
gacagccctcatgtagtcaaatattatggcagttattttaagaacacagacttatggatc
gttatggagtactgtggggctggttctgtatctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggacttgaatacctt
cattttatgagaaaaatacaccgagatatcaaggcaggaaatattttgctaaatacagaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagataccatggccaag
cggaatacagtgataggaacaccattttggatggctccagaagtgattcaggaaattgga
tacaactgtgtagcagacatctggtccctgggaataactgccatagaaatggctgaagga
aagcccccttatgctgatatccatccaatgagggcaatcttcatgattcctacaaatcct
cctcccacattccgaaaaccagagctatggtcagataactttacagattttgtgaaacag
tgtcttgtaaagagccctgagcagagggccacagccactcagctcctgcagcacccattt
gtcaggagtgccaaaggagtgtcaatactgcgagacttaattaatgaagccatggatgtg
aaactgaaacgccaggaatcccagcagcgggaagtggaccaggacgatgaagaaaactca
gaagaggatgaaatggattctggcacgatggttcgagcagtgggtgatgagatgggcact
gtccgagtagccagcaccatgactgatggagccaatactatgattgagcacgatgacacg
ttgccatcacaactgggcaccatggtgatcaatgcagaggatgaggaagaggaaggaact
atgaaaagaagggatgagaccatgcagcctgcgaaaccatcctttcttgaatattttgaa
caaaaagaaaaggaaaaccagatcaacagctttggcaagagtgtacctggtccactgaaa
aattcttcagattggaaaataccacaggatggagactacgagtttcttaagagttggaca
gtggaggaccttcagaagaggctcttggccctggaccccatgatggagcaggagattgaa
gagatccggcagaagtaccagtccaagcggcagcccatcctggatgccatagaggctaag
aagagacggcaacaaaacttctga

DBGET integrated database retrieval system