KEGG   Homo sapiens (human): 6792Help
Entry
6792              CDS       T01001                                 

Gene name
CDKL5, CFAP247, EIEE2, ISSX, STK9
Definition
(RefSeq) cyclin dependent kinase like 5 (EC:2.7.11.22)
  KO
K08824  
cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Disease
H00478  
Prader-Willi and Angelman syndromes
H00606  
Early infantile epileptic encephalopathy
H01460  
West syndrome
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     6792 (CDKL5)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDKL family
   6792 (CDKL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22
AA seq 1030 aa AA seqDB search
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRE
LKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLI
KAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSP
ELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYS
NPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ
RLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGLPRADEGL
PANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLTNNNIPHLLSPKEAKSKTEFDFN
IDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQSKAGTLQPNEKQSRHSYIDTIPQSSRSP
SYRTKAKSHGALSDSKSVSNLSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRT
LLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVA
RSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPS
PRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFF
RSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQTQSQPLKSLR
KLLHLSSASNHPASSDPRFQPLTAQQTKNSFSEIRIHPLSQASGGSSNIRQEPAPKGRPA
LQLPDGGCDGRRQRHHSGPQDRRFMLRTTEQQGEYFCCGDPKKPHTPCVPNRALHRPISS
PAPYPVLQVRGTSMCPTLQVRGTDAFSCPTQQSGFSFFVRHVMREALIHRAQVNQAALLT
YHENAALTGK
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcctaacattggtaatgtgatgaataaatttgagatccttggggttgtaggt
gaaggagcctatggagttgtacttaaatgcagacacaaggaaacacatgaaattgtggcg
atcaagaaattcaaggacagtgaagaaaatgaagaagtcaaagaaacgactttacgagag
cttaaaatgcttcggactctcaagcaggaaaacattgtggagttgaaggaagcatttcgt
cggaggggaaagttgtacttggtgtttgagtatgttgaaaaaaatatgctcgaattgctg
gaagaaatgccaaatggagttccacctgagaaagtaaaaagctacatctatcagctaatc
aaggctattcactggtgccataagaatgatattgtccatcgagatataaaaccagaaaat
ctcttaatcagccacaatgatgtcctaaaactgtgtgactttggttttgctcgtaatctg
tcagaaggcaataatgctaattacacagagtacgttgccaccagatggtatcggtcccca
gaactcttacttggcgctccctatggaaagtccgtggacatgtggtcggtgggctgtatt
cttggggagcttagcgatggacagcctttatttcctggagaaagtgaaattgaccaactt
tttactattcagaaggtgctaggaccacttccatctgagcagatgaagcttttctacagt
aatcctcgcttccatgggctccggtttccagctgttaaccatcctcagtccttggaaaga
agataccttggaattttgaatagtgttctacttgacctaatgaagaatttactgaagttg
gacccagctgacagatacttgacagaacagtgtttgaatcaccctacatttcaaacccag
agacttctggatcgttctccttcaaggtcagcaaaaagaaaaccttaccatgtggaaagc
agcacattgtctaatagaaaccaagccggcaaaagtactgctttgcagtctcaccacaga
tctaacagcaaggacatccagaacctgagtgtaggcctgccccgggctgacgaaggtctc
cctgccaatgaaagcttcctaaatggaaaccttgctggagctagtcttagtccactgcac
accaaaacctaccaagcaagcagccagcctgggtctaccagcaaagatctcaccaacaac
aacataccacaccttcttagcccaaaagaagccaagtcaaaaacagagtttgattttaat
attgacccaaagccttcagaaggcccagggacaaagtacctcaagtcaaacagcagatct
cagcagaaccgccactcattcatggaaagctctcaaagcaaagctgggacactgcagccc
aatgaaaagcagagtcggcatagctatattgacacaattccccagtcctctaggagtccc
tcctacaggaccaaggccaaaagccatggggcactgagtgactccaagtctgtgagcaac
ctttctgaagccagggcccaaattgcggagcccagtaccagtaggtacttcccatctagc
tgcttagacttgaattctcccaccagcccaacccccaccagacacagtgacacgagaact
ttgctcagcccttctggaagaaataaccgaaatgagggaacgctggactcacgtcgaacc
acaaccagacattctaagacgatggaggaattgaagctgccggagcacatggacagtagc
cattcccattcactgtctgcacctcacgaatctttttcttatggactgggctacaccagc
cccttttcttcccagcaacgtcctcataggcattctatgtatgtgacccgtgacaaagtg
agagccaagggcttggatggaagcttgagcatagggcaagggatggcagctagagccaac
agcctgcaactcttgtcaccccagcctggagaacagctccctccagagatgactgtggca
agatcttcggtcaaagagacctccagagaaggcacctcttccttccatacacgccagaag
tctgagggtggagtgtatcatgacccacactctgatgatggcacagcccccaaagaaaat
agacacctatacaatgatcctgtgccaaggagagttggtagcttttacagagtgccatct
ccacgtccagacaattctttccatgaaaataatgtgtcaactagagtttcttctctacca
tcagagagcagttctggaaccaaccactcaaaaagacaaccagcattcgatccatggaaa
agtcctgaaaatattagtcattcagagcaactcaaggaaaaagagaagcaaggatttttc
aggtcaatgaaaaagaaaaagaagaaatctcaaacagtacccaattccgacagccctgat
cttctgacgttgcagaaatccattcattctgctagcactccaagcagcagaccaaaggag
tggcgccccgagaagatctcagatctgcagacccaaagccagccattaaaatcactgcgc
aagttgttacatctctcttcggcctcaaatcacccggcttcctcagatccccgcttccag
cccttaacagctcaacaaaccaaaaattccttctcagaaattcggattcaccccctgagc
caggcctctggcgggagcagcaacatccggcaggaacccgcaccgaagggcaggccagcc
ctccagctgccagacggtggatgtgatggcagaagacagagacaccattctggaccccaa
gatagacgcttcatgttaaggacgacagaacaacaaggagaatacttctgctgtggtgac
ccaaagaagcctcacactccgtgcgtcccaaaccgagcccttcatcgtccaatctccagt
cctgctccctatccagtactccaggtccgaggcacttccatgtgcccgacactccaggtc
cgaggcactgatgctttcagctgcccaacccagcaatccgggttctctttcttcgtgaga
cacgttatgagggaagccctgattcacagggcccaggtaaaccaagctgcgctcctgaca
taccatgagaatgcggcactgacgggcaagtga

DBGET integrated database retrieval system