KEGG   Homo sapiens (human): 6792Help
Entry
6792              CDS       T01001                                 

Gene name
CDKL5, CFAP247, EIEE2, ISSX, STK9
Definition
(RefSeq) cyclin dependent kinase like 5
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Disease
H00606  Early infantile epileptic encephalopathy
H01460  West syndrome
H01732  Angelman syndrome (AS)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     6792 (CDKL5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   6792 (CDKL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 6792
NCBI-ProteinID: NP_001032420
OMIM: 300203
HGNC: 11411
Ensembl: ENSG00000008086
Vega: OTTHUMG00000021214
Pharos: O76039(Tchem)
UniProt: O76039
Structure
PDB: 

Jmol
Position
Xp22.13
AA seq 1030 aa AA seqDB search
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRE
LKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLI
KAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSP
ELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYS
NPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ
RLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHRSNSKDIQNLSVGLPRADEGL
PANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLTNNNIPHLLSPKEAKSKTEFDFN
IDPKPSEGPGTKYLKSNSRSQQNRHSFMESSQSKAGTLQPNEKQSRHSYIDTIPQSSRSP
SYRTKAKSHGALSDSKSVSNLSEARAQIAEPSTSRYFPSSCLDLNSPTSPTPTRHSDTRT
LLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVA
RSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPS
PRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFF
RSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQTQSQPLKSLR
KLLHLSSASNHPASSDPRFQPLTAQQTKNSFSEIRIHPLSQASGGSSNIRQEPAPKGRPA
LQLPDGGCDGRRQRHHSGPQDRRFMLRTTEQQGEYFCCGDPKKPHTPCVPNRALHRPISS
PAPYPVLQVRGTSMCPTLQVRGTDAFSCPTQQSGFSFFVRHVMREALIHRAQVNQAALLT
YHENAALTGK
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcctaacattggtaatgtgatgaataaatttgagatccttggggttgtaggt
gaaggagcctatggagttgtacttaaatgcagacacaaggaaacacatgaaattgtggcg
atcaagaaattcaaggacagtgaagaaaatgaagaagtcaaagaaacgactttacgagag
cttaaaatgcttcggactctcaagcaggaaaacattgtggagttgaaggaagcatttcgt
cggaggggaaagttgtacttggtgtttgagtatgttgaaaaaaatatgctcgaattgctg
gaagaaatgccaaatggagttccacctgagaaagtaaaaagctacatctatcagctaatc
aaggctattcactggtgccataagaatgatattgtccatcgagatataaaaccagaaaat
ctcttaatcagccacaatgatgtcctaaaactgtgtgactttggttttgctcgtaatctg
tcagaaggcaataatgctaattacacagagtacgttgccaccagatggtatcggtcccca
gaactcttacttggcgctccctatggaaagtccgtggacatgtggtcggtgggctgtatt
cttggggagcttagcgatggacagcctttatttcctggagaaagtgaaattgaccaactt
tttactattcagaaggtgctaggaccacttccatctgagcagatgaagcttttctacagt
aatcctcgcttccatgggctccggtttccagctgttaaccatcctcagtccttggaaaga
agataccttggaattttgaatagtgttctacttgacctaatgaagaatttactgaagttg
gacccagctgacagatacttgacagaacagtgtttgaatcaccctacatttcaaacccag
agacttctggatcgttctccttcaaggtcagcaaaaagaaaaccttaccatgtggaaagc
agcacattgtctaatagaaaccaagccggcaaaagtactgctttgcagtctcaccacaga
tctaacagcaaggacatccagaacctgagtgtaggcctgccccgggctgacgaaggtctc
cctgccaatgaaagcttcctaaatggaaaccttgctggagctagtcttagtccactgcac
accaaaacctaccaagcaagcagccagcctgggtctaccagcaaagatctcaccaacaac
aacataccacaccttcttagcccaaaagaagccaagtcaaaaacagagtttgattttaat
attgacccaaagccttcagaaggcccagggacaaagtacctcaagtcaaacagcagatct
cagcagaaccgccactcattcatggaaagctctcaaagcaaagctgggacactgcagccc
aatgaaaagcagagtcggcatagctatattgacacaattccccagtcctctaggagtccc
tcctacaggaccaaggccaaaagccatggggcactgagtgactccaagtctgtgagcaac
ctttctgaagccagggcccaaattgcggagcccagtaccagtaggtacttcccatctagc
tgcttagacttgaattctcccaccagcccaacccccaccagacacagtgacacgagaact
ttgctcagcccttctggaagaaataaccgaaatgagggaacgctggactcacgtcgaacc
acaaccagacattctaagacgatggaggaattgaagctgccggagcacatggacagtagc
cattcccattcactgtctgcacctcacgaatctttttcttatggactgggctacaccagc
cccttttcttcccagcaacgtcctcataggcattctatgtatgtgacccgtgacaaagtg
agagccaagggcttggatggaagcttgagcatagggcaagggatggcagctagagccaac
agcctgcaactcttgtcaccccagcctggagaacagctccctccagagatgactgtggca
agatcttcggtcaaagagacctccagagaaggcacctcttccttccatacacgccagaag
tctgagggtggagtgtatcatgacccacactctgatgatggcacagcccccaaagaaaat
agacacctatacaatgatcctgtgccaaggagagttggtagcttttacagagtgccatct
ccacgtccagacaattctttccatgaaaataatgtgtcaactagagtttcttctctacca
tcagagagcagttctggaaccaaccactcaaaaagacaaccagcattcgatccatggaaa
agtcctgaaaatattagtcattcagagcaactcaaggaaaaagagaagcaaggatttttc
aggtcaatgaaaaagaaaaagaagaaatctcaaacagtacccaattccgacagccctgat
cttctgacgttgcagaaatccattcattctgctagcactccaagcagcagaccaaaggag
tggcgccccgagaagatctcagatctgcagacccaaagccagccattaaaatcactgcgc
aagttgttacatctctcttcggcctcaaatcacccggcttcctcagatccccgcttccag
cccttaacagctcaacaaaccaaaaattccttctcagaaattcggattcaccccctgagc
caggcctctggcgggagcagcaacatccggcaggaacccgcaccgaagggcaggccagcc
ctccagctgccagacggtggatgtgatggcagaagacagagacaccattctggaccccaa
gatagacgcttcatgttaaggacgacagaacaacaaggagaatacttctgctgtggtgac
ccaaagaagcctcacactccgtgcgtcccaaaccgagcccttcatcgtccaatctccagt
cctgctccctatccagtactccaggtccgaggcacttccatgtgcccgacactccaggtc
cgaggcactgatgctttcagctgcccaacccagcaatccgggttctctttcttcgtgaga
cacgttatgagggaagccctgattcacagggcccaggtaaaccaagctgcgctcctgaca
taccatgagaatgcggcactgacgggcaagtga

DBGET integrated database retrieval system