KEGG   Homo sapiens (human): 6804Help
Entry
6804              CDS       T01001                                 

Gene name
STX1A, HPC-1, P35-1, STX1, SYN1A
Definition
syntaxin 1A (brain)
Orthology
K04560  
syntaxin 1A
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Synaptic vesicle cycle
Insulin secretion
Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6804 (STX1A)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    6804 (STX1A)
  Nervous system
   04721 Synaptic vesicle cycle
    6804 (STX1A)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    6804 (STX1A)
SNAREs [BR:hsa04131]
 Syntaxin (Qa)
  Stx-PM
   6804 (STX1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.23
AA seq 251 aa AA seqDB search
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPS
STRARRAGRKS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgatgatgatgatgtc
gctgtcaccgtggaccgagaccgcttcatggatgagttctttgagcaggtggaggagatt
cgaggcttcattgacaagatcgcagagaacgtggaggaggtgaagcggaagcacagtgcc
atcctggcatcccccaaccccgatgagaagacgaaggaggagctggaagaactcatgtcc
gacataaagaagacagcaaacaaagttcgttccaagttaaagagcatcgagcagtccatc
gagcaagaggaaggcctgaaccgctcctccgctgacctgaggatccggaagacacagcac
tccacgctgtccagaaagtttgtggaggtcatgtcggagtacaacgccacgcagtccgac
taccgcgagcgctgcaaaggccgcatccagaggcagctggagatcaccggcaggaccacg
accagtgaggagctggaggacatgctggagagtgggaaccccgccatctttgcctctggg
atcatcatggactccagcatctcgaagcaggctctgagcgagattgagacgcggcacagt
gagatcatcaagctggagaacagcatccgtgagctacacgacatgttcatggacatggcc
atgctcgtggagagccagactatgtggagagggccgtgtctgacaccaagaaggccgtca
agtaccagagcaaggcgcgccggaagaaaatcatga

DBGET integrated database retrieval system