KEGG   Homo sapiens (human): 6811Help
Entry
6811              CDS       T01001                                 

Gene name
STX5, SED5, STX5A
Definition
syntaxin 5
Orthology
K08490  
syntaxin 5
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6811 (STX5)
SNAREs [BR:hsa04131]
 Syntaxin (Qa)
  Stx-cisGolgi
   6811 (STX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.3
AA seq 321 aa AA seqDB search
MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDR
TQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAK
RKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQ
SKLASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSALPLAPNHLGGGAVVLGAESHAS
KDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEET
IQSVLLFPLLPALSPGSTRTC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcggaaacgctacgggtctaagaacacggatcagggtgtctacctgggtctc
tcaaagacacaggtcctgtcccctgcaactgctggcagtagcagcagcgacatcgcccct
ctgccccccccagtgaccctcgtccctccccctcccgacaccatgtcctgccgggatcgg
acccaggagtttctgtctgcctgcaagtcgctgcagacccgtcagaatggaatccagaca
aataagccagctttgcgtgctgtccgacaacgcagtgaattcaccctcatggccaagcgc
attgggaaagaccttagcaacacatttgccaagctggagaagctgacaatcttggcaaag
cgcaagtccctctttgatgataaagcagtggaaattgaagagctaacatatatcatcaaa
caggacatcaatagcctcaacaaacaaattgctcagctccaggatttcgtgagagccaag
ggcagccagagtggccggcacctgcagacccactccaacaccattgtggtctccttgcag
tcgaaactggcttctatgtccaatgacttcaaatcggttttagaagtgaggacagagaac
ctgaagcagcagaggagccggagagagcagttctcccgggcacctgtgtcagccctgccc
cttgcccctaaccacctgggcggtggtgctgtggttctgggggcagagtcccatgcctcc
aaggatgtcgccatcgacatgatggactctcggaccagccagcagctgcagctcattgac
gagcaggattcctacatccagagtcgggcagacaccatgcagaacattgagtcgacaatt
gttgagttgggctccatctttcagcagttggcacacatggttaaggaacaggaggaaacc
attcagagtgtccttttgtttcctcttctcccggccttgtccccaggatcgacgagaacg
tgctag

DBGET integrated database retrieval system