KEGG   Homo sapiens (human): 6811Help
Entry
6811              CDS       T01001                                 

Gene name
STX5, SED5, STX5A
Definition
(RefSeq) syntaxin 5
  KO
K08490  syntaxin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6811 (STX5)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-cisGolgi
    6811 (STX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNARE Syntaxin-5_N Syntaxin DUF16 SKA1 Vac_Fusion DUF5063 DUF3130 MCPsignal DUF1664 Apolipoprotein
Motif
Other DBs
NCBI-GeneID: 6811
NCBI-ProteinID: NP_003155
OMIM: 603189
HGNC: 11440
Ensembl: ENSG00000162236
Vega: OTTHUMG00000143864
Pharos: Q13190(Tbio)
UniProt: Q13190
Position
11q12.3
AA seq 355 aa AA seqDB search
MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDR
TQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAK
RKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQ
SKLASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSALPLAPNHLGGGAVVLGAESHAS
KDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEET
IQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcggaaacgctacgggtctaagaacacggatcagggtgtctacctgggtctc
tcaaagacacaggtcctgtcccctgcaactgctggcagtagcagcagcgacatcgcccct
ctgccccccccagtgaccctcgtccctccccctcccgacaccatgtcctgccgggatcgg
acccaggagtttctgtctgcctgcaagtcgctgcagacccgtcagaatggaatccagaca
aataagccagctttgcgtgctgtccgacaacgcagtgaattcaccctcatggccaagcgc
attgggaaagaccttagcaacacatttgccaagctggagaagctgacaatcttggcaaag
cgcaagtccctctttgatgataaagcagtggaaattgaagagctaacatatatcatcaaa
caggacatcaatagcctcaacaaacaaattgctcagctccaggatttcgtgagagccaag
ggcagccagagtggccggcacctgcagacccactccaacaccattgtggtctccttgcag
tcgaaactggcttctatgtccaatgacttcaaatcggttttagaagtgaggacagagaac
ctgaagcagcagaggagccggagagagcagttctcccgggcacctgtgtcagccctgccc
cttgcccctaaccacctgggcggtggtgctgtggttctgggggcagagtcccatgcctcc
aaggatgtcgccatcgacatgatggactctcggaccagccagcagctgcagctcattgac
gagcaggattcctacatccagagtcgggcagacaccatgcagaacattgagtcgacaatt
gttgagttgggctccatctttcagcagttggcacacatggttaaggaacaggaggaaacc
attcagaggatcgacgagaacgtgctaggagcccagctggacgttgaggccgcccattca
gagatcctcaagtacttccagtctgtcacctccaaccggtggctcatggtcaaaatcttc
ctcatcctcattgtcttcttcatcatctttgtggtcttccttgcttga

DBGET integrated database retrieval system