KEGG   Homo sapiens (human): 683Help
Entry
683               CDS       T01001                                 

Gene name
BST1, CD157
Definition
(RefSeq) bone marrow stromal cell antigen 1
  KO
K18152  
ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Salivary secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    683 (BST1)
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    683 (BST1)
   04972 Pancreatic secretion
    683 (BST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     683 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     683 (BST1)
CD molecules [BR:hsa04090]
 Proteins
  683 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  683 (BST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q10588(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
4p15.32
AA seq 318 aa AA seqDB search
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSP
EQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFA
DNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYS
KDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGE
GSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQ
RAGLIIPLFLVLASRTQL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccaggggtgcgcggcatcgcggctgctccagctgctgctgcagcttctgctt
ctactgttgctgctggcggcgggcggggcgcgcgcgcggtggcgcggggagggcaccagc
gcacacttgcgggacatcttcctgggccgctgcgccgagtaccgcgcactgctgagtccc
gagcagcggaacaagaactgcacagccatctgggaagcctttaaagtggcgctggacaag
gatccctgctccgtgctgccctcagactatgacctttttattaacttgtccaggcactct
attcccagagataagtccctgttctgggaaaatagccacctccttgttaacagctttgca
gacaacacccgtcgttttatgcccctgagcgatgttctgtatggcagggttgcagatttc
ttgagctggtgtcgacagaaaaatgactctggactcgattaccaatcctgccctacatca
gaagactgtgaaaataatcctgtggattccttttggaaaagggcatccatccagtattcc
aaggatagttctggggtgatccacgtcatgctgaatggttcagagccaacaggagcctat
cccatcaaaggtttttttgcagattatgaaattccaaacctccagaaggaaaaaattaca
cgaatcgagatctgggttatgcatgaaattgggggacccaatgtggaatcctgcggggaa
ggcagcatgaaagtcctggaaaagaggctgaaggacatggggttccagtacagctgtatt
aatgattaccgaccagtgaagctcttacagtgcgtggaccacagcacccatcctgactgt
gccttaaagtcggcagcagccgctactcaaagaaaagccccaagtctttatacagaacaa
agggcgggtcttatcattcccctctttctggtgctggcttccaggactcaactgtaa

DBGET integrated database retrieval system