KEGG   Homo sapiens (human): 686Help
Entry
686               CDS       T01001                                 

Gene name
BTD
Definition
biotinidase (EC:3.5.1.12)
Orthology
K01435  
biotinidase [EC:3.5.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
Biotin metabolism
Metabolic pathways
Vitamin digestion and absorption
Disease
H01182  
Biotinidase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    686 (BTD)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    686 (BTD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.12  biotinidase
     686 (BTD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 543 aa AA seqDB search
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVA
AVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNF
TRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRF
GIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAAN
VHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSN
GLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATG
IFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLY
ERD
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatgcgcatattcagggcggaaggcgcgctaagagcagatttgtggtctgcatt
atgtctggagccagaagtaagcttgctcttttcctctgcggctgttacgtggttgccctg
ggagcccacaccggggaggagagcgtggctgaccatcacgaggctgaatattatgtggct
gccgtgtatgagcatccatccatcctgagtctgaaccctctggctctcatcagccgccaa
gaggccttggagctcatgaaccagaaccttgacatctatgaacagcaagtgatgactgca
gcccaaaaggatgtacagattatagtgtttccagaagatggcattcatggattcaacttt
acaagaacatccatttatccatttttggacttcatgccgtctccccaggtggtcaggtgg
aacccatgcctggagcctcaccgcttcaatgacacagaggtgctccagcgcctgagttgt
atggccatcaggggagatatgttcttggtggccaatcttgggacaaaggagccttgtcat
agcagtgacccaaggtgcccaaaagatgggagataccagttcaacacaaatgtcgtgttc
agcaataatggaacccttgttgaccgctaccgtaaacacaacctctactttgaggcagca
ttcgatgttcctcttaaagtggatctcatcacctttgataccccctttgctggcaggttt
ggcatcttcacatgctttgatatattgttctttgaccctgccatcagagtcctcagagac
tacaaggtgaagcatgttgtgtacccaactgcctggatgaaccagctcccactcttggca
gcaattgagattcagaaagcttttgctgttgcctttggcatcaacgttctggcagctaat
gtccaccacccagttctggggatgacaggaagtggcatacacacccctctggagtccttt
tggtaccatgacatggaaaatcccaaaagtcaccttataattgcccaggtggccaaaaat
ccagtgggtctcattggtgcagagaatgcaacaggtgaaacggacccatcccatagtaag
tttttaaaaattttgtcaggcgatccgtactgtgagaaggatgctcaggaagtccactgt
gatgaggccaccaagtggaacgtgaatgctcctcccacatttcactctgagatgatgtat
gacaatttcaccctggtccctgtctggggaaaggaaggctatctccacgtctgttccaat
ggcctctgctgttatttactttacgagaggcccaccttatccaaagagctgtatgccctg
ggggtctttgatgggcttcacacagtacatggcacttactacatccaagtgtgtgccctg
gtcaggtgtgggggtcttggcttcgacacctgtggacaggaaatcacagaggccacgggg
atatttgagtttcacctgtggggcaacttcagtacttcctatatctttcctttgtttctg
acctcagggatgaccctagaagtccctgaccagcttggctgggagaatgaccactatttc
ctgaggaaaagtaggctgtcctctgggctggtgacggcggctctctatgggcgcttgtat
gagagggactag

DBGET integrated database retrieval system