KEGG   Homo sapiens (human): 686Help
Entry
686               CDS       T01001                                 

Gene name
BTD
Definition
biotinidase (EC:3.5.1.12)
Orthology
K01435  
biotinidase [EC:3.5.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
Biotin metabolism
Metabolic pathways
Vitamin digestion and absorption
Disease
H01182  
Biotinidase deficiency
Class
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:hsa00780]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 543 aa AA seqDB search
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVA
AVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNF
TRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCH
SSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRF
GIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAAN
VHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSK
FLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSN
GLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATG
IFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLY
ERD
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatgcgcatattcagggcggaaggcgcgctaagagcagatttgtggtctgcatt
atgtctggagccagaagtaagcttgctcttttcctctgcggctgttacgtggttgccctg
ggagcccacaccggggaggagagcgtggctgaccatcacgaggctgaatattatgtggct
gccgtgtatgagcatccatccatcctgagtctgaaccctctggctctcatcagccgccaa
gaggccttggagctcatgaaccagaaccttgacatctatgaacagcaagtgatgactgca
gcccaaaaggatgtacagattatagtgtttccagaagatggcattcatggattcaacttt
acaagaacatccatttatccatttttggacttcatgccgtctccccaggtggtcaggtgg
aacccatgcctggagcctcaccgcttcaatgacacagaggtgctccagcgcctgagttgt
atggccatcaggggagatatgttcttggtggccaatcttgggacaaaggagccttgtcat
agcagtgacccaaggtgcccaaaagatgggagataccagttcaacacaaatgtcgtgttc
agcaataatggaacccttgttgaccgctaccgtaaacacaacctctactttgaggcagca
ttcgatgttcctcttaaagtggatctcatcacctttgataccccctttgctggcaggttt
ggcatcttcacatgctttgatatattgttctttgaccctgccatcagagtcctcagagac
tacaaggtgaagcatgttgtgtacccaactgcctggatgaaccagctcccactcttggca
gcaattgagattcagaaagcttttgctgttgcctttggcatcaacgttctggcagctaat
gtccaccacccagttctggggatgacaggaagtggcatacacacccctctggagtccttt
tggtaccatgacatggaaaatcccaaaagtcaccttataattgcccaggtggccaaaaat
ccagtgggtctcattggtgcagagaatgcaacaggtgaaacggacccatcccatagtaag
tttttaaaaattttgtcaggcgatccgtactgtgagaaggatgctcaggaagtccactgt
gatgaggccaccaagtggaacgtgaatgctcctcccacatttcactctgagatgatgtat
gacaatttcaccctggtccctgtctggggaaaggaaggctatctccacgtctgttccaat
ggcctctgctgttatttactttacgagaggcccaccttatccaaagagctgtatgccctg
ggggtctttgatgggcttcacacagtacatggcacttactacatccaagtgtgtgccctg
gtcaggtgtgggggtcttggcttcgacacctgtggacaggaaatcacagaggccacgggg
atatttgagtttcacctgtggggcaacttcagtacttcctatatctttcctttgtttctg
acctcagggatgaccctagaagtccctgaccagcttggctgggagaatgaccactatttc
ctgaggaaaagtaggctgtcctctgggctggtgacggcggctctctatgggcgcttgtat
gagagggactag

DBGET integrated database retrieval system