KEGG   Homo sapiens (human): 6874Help
Entry
6874              CDS       T01001                                 

Gene name
TAF4, TAF2C, TAF2C1, TAF4A, TAFII130, TAFII135
Definition
(RefSeq) TATA-box binding protein associated factor 4
  KO
K03129  
transcription initiation factor TFIID subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Huntington's disease
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    6874 (TAF4)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    6874 (TAF4)
  Infectious diseases
   05168 Herpes simplex infection
    6874 (TAF4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6874 (TAF4)
   Coactivators
    SAGA/TFTC/STAGA complex
     6874 (TAF4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TFTC complex
     6874 (TAF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O00268(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.33
AA seq 1085 aa AA seqDB search
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGN
HVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPA
PPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGP
GPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQT
PPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPP
AAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQT
LAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATT
SGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQA
HAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATL
QRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFL
STLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRS
LPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPP
VLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTP
QQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASM
AGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVS
YVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKV
DCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLY
KAFLK
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggctcggatctgctggacgaggtcttcttcaacagcgaggtggacgagaaa
gtggtgagcgacctggtgggctcgctggagtcgcagctggcggccagcgcggcccaccac
caccacctcgcgccgcgcacgcccgaggtgcgggccgcggccgccggcgcgctcgggaac
catgttgtgagcggcagcccggccggagccgcgggcgcagggccggccgcccccgccgag
ggcgcgcccggagcggcgccggagccgccccccgcaggtagagcgcggccggggggcggg
gggccgcagcgcccgggccccccctcaccgcgccgcccccttgtccccgcagggcccgcg
ccgcccgccgcgaagctgaggccgccgcccgagggcagcgcggggtcctgcgccccggtg
cccgccgccgccgccgtcgccgcggggcccgagcccgcccccgccggccccgccaagccc
gccggccccgccgcgctggccgcccgcgccggccccggccccgggcccggccccggcccc
ggccccggccctggccctggcaagcccgccggccccggcgccgcgcaaactttgaatggg
agcgccgcgctgctgaactcgcaccacgccgccgcacctgctgtcagcctggtcaacaac
gggcccgccgcgctgctgccgctgcccaagcccgccgcccccggcactgtcatccagacg
ccccccttcgtgggcgccgccgcgccccccgcgcccgccgcgccctcgccccccgccgcc
cccgcgcccgccgcccccgccgccgccccgcccccgccaccccccgcgcccgccactctg
gcccggccgcccggccaccccgccggacccccgaccgccgcgcccgccgtgccgcccccc
gccgccgcccagaacgggggcagcgccggggcagcccccgcccccgccccggccgccggg
ggccccgcgggggtcagcggccaacccgggcccggcgcggcggctgcggcgccggcgccg
ggggtcaaggccgagtcgcccaagagggtggtgcaggcggcgcccccggcggcgcagacc
ctggcggccagcggcccggccagcacggcggccagcatggtcatcgggccaactatgcaa
ggggcgctgcccagcccggccgccgtcccgccgcccgcccccgggacccccaccgggctg
cccaaaggcgcggccggcgcagtgacccagagcctgtcccggacgcccacggccaccacc
agcgggattcgggccaccctgacgcccaccgtgctggccccccgcttgccgcagccgcct
cagaacccgaccaacatccagaacttccagctgcccccaggaatggtcctcgtccgaagt
gagaatgggcagttgttaatgattcctcagcaggccttggcccagatgcaggcgcaggcc
catgcccagcctcagaccaccatggcgcctcgccctgccacccccacaagtgcccctccc
gtccagatctccaccgtacaggcacctggaacacctatcattgcacggcaggtgacccca
actaccataattaagcaagtgtctcaggcccagacaacggtgcagcccagtgcaaccctg
cagcgctcgcccggcgtccagcctcagctcgttctgggtggcgctgcccagacggcttca
cttgggacggcgacggctgttcagacggggactcctcagcgcacggtaccaggggcgacc
accacttcctcagctgccacggaaactatggaaaacgtgaagaaatgtaaaaatttccta
tctacgttaataaaactggcttcatctggcaagcagtctacagagacagcagctaatgtg
aaagagctcgtgcagaatttactggatggaaaaatagaagcagaagatttcacaagcagg
ttataccgagaacttaattcttcacctcaaccttaccttgtgcctttcctgaagaggagc
ttacccgccttgagacagctgacccccgactccgcggccttcatccagcagagccagcag
cagccgccaccgcccacctcgcaggccaccactgcgctcacggccgtggtgctgagtagc
tcggtccagcgcacggccgggaagacggcggccaccgtgaccagtgccctccagccccct
gtgctcagcctcacgcagcccacgcaggtcggcgtcggcaagcaggggcaacccacaccg
ctggtcatccagcagcctccgaagccaggagccctgatccggcccccgcaggtgacgttg
acgcagacacccatggtcgccctgcggcagcctcacaaccggatcatgctcaccacgcct
cagcagatccagctgaacccactgcagccagtccctgtggtgaaacccgccgtgttacct
ggaaccaaagccctttctgctgtctcggcacaagcagctgctgcacagaaaaataaactc
aaggagcctgggggaggttcgtttcgggacgatgatgacattaatgatgttgcatcgatg
gctggagtaaacttgtcagaagaaagtgcaagaatattagccacgaactctgaattggtg
ggcacgctaacgcggtcctgtaaagatgaaaccttcctcctccaagcgcctttgcagaga
agaatattagaaataggtaaaaaacatggtataacggaattacatccagatgtagtaagt
tatgtatcacatgccacgcaacaaaggctacagaatcttgtagagaaaatatcagaaaca
gctcagcagaagaacttttcttacaaggatgacgacagatatgagcaggcgagtgacgtc
cgggcacagctcaagttttttgaacagcttgatcaaatcgaaaagcagaggaaggatgag
caggagcgggagatcctgatgagggcagcaaagtctcggtcaagacaagaagatccagaa
cagttaaggctgaaacagaaggcaaaggagatgcagcaacaggaactggcacaaatgaga
cagcgggacgccaacctcacagcactagcagcgatcgggcccaggaaaaagaggaaagtg
gactgtccggggccgggctcaggagcagaggggtcgggccccggctcagtggtcccaggc
agctcgggtgtcggaacccccagacagttcacgcgacaaagaatcacgcgggtcaacctc
agggacctcatattttgtttagaaaatgaacgtgagacaagccattcactgctgctctac
aaagcattccttaagtga

DBGET integrated database retrieval system